SteamHistory
Alias SearchAvatar SearchURL SearchBulk SearchAPIComment SearchMulti-Source Search
[ Supporter Features ]
Alias SearchAvatar SearchURL SearchBulk SearchAPIComment SearchMulti-Source Search
[ Supporter Features ]
[ Supporter Features ]
[ Supporter Features ]
SteamID64: 76561197963767811
SteamID32: [U:1:3502083]
SteamID: STEAM_0:1:1751041
CommunityURL: https://steamcommunity.com/id/gentlecatt/
ProfileURL: https://steamcommunity.com/profiles/76561197963767811
You must log in to use these features
Status: Offline
Privacy: Public
Profile Setup: True
Premium: True
Creation: 2004-01-06 11:27:17 (GMT)
Last Updated: 2024-03-03 15:45:36
VAC Banned: False
Community Banned: False
Game Banned: False
Trade Banned: False
| Name | Time Changed |
|---|---|
| Pepi | 2023-03-22 00:54:22 [Estimated] |
| RealName | Time Changed |
|---|---|
| Also Blastorgue sometimes | 2023-12-17 23:13:24 |
| Also Blastorgue sometimes | 2023-03-22 00:54:22 |
| URL | Time Changed |
|---|---|
| https://steamcommunity.com/id/gentlecatt/ | 2023-03-22 00:54:22 |
| State | Time Changed |
|---|---|
| Public | 2023-12-17 23:13:24 |
| Private | 2023-12-12 18:07:37 |
| Commenter | Message | Timestamp |
|---|---|---|
| Tarka | I know how to überchain thanks to This baguette guy for 11 years +1 day!✨ | 2024-01-11 04:11:00 |
| mimoonet | <3 | 2023-07-26 05:26:50 |
| jbrog | dope dude! | 2023-01-19 01:54:04 |
| Tarka | This baguette right here,This baguette showed me how 2 medics can bring nightmares upon the enemy tf2 blu team by slicing-em-up on the Upward battlefield 10 years ago! It's been a decade since I had been taught the joyful coop activity, aka the überchain✨!Herr Doctah Baguette, Thank You for inviting me to be your stabbing companion on that day. We sure showed them those blus how to wear red properly. Und Danke schön for all the wunderbar moments, laughters, games, accidentally thrown grenades and screamings afterwards, the bl2 Krieg DLC, the warframe spy mission sneaks and fails, the Shepard-Wrex goodbyes, the Overwatch spraying battles and dances, the fo76 camp tours, the mutual Godd praisings, and quickly adapting to all my crazy ideas and random shenanigans (altho you should slow down on that, I might ran out of improvisations xd). Looking forward to hit more anniversaries with you, mr super secret baguette agent 007! Köszönöm c: | 2023-01-10 16:59:03 |
| Pepi | Thanks a lot for the comments! I appreciate! | 2023-01-10 12:01:33 |
| SShadesZ | Great review of High On LIfe. I might actually get it now (when it's on sale as you suggested). | 2023-01-09 01:57:19 |
| Tom Zanetti | i really liked your review of high on life, i felt like it was exactly what i thought of it! well done and thanks! | 2023-01-08 20:13:36 |
| Cyan | It's kittypuppy-versary! Happy 11 years, Pepi! | 2022-03-18 07:28:30 |
| Tarka | Happy 9th überchain anniversary!! ✨ \o/this good Baguette is still a good Baguette | 2022-01-09 19:06:34 |
| Orbit | Sexy new profile look | 2021-04-26 10:26:19 |
| mimoonet | Tagada Tsoin Tsoinnnnn | 2020-11-09 08:14:52 |
| panda | -HUG- | 2020-07-05 10:58:50 |
| panda | -hug- | 2019-12-02 13:51:59 |
| Tarka | Hey man, thanks for the überchain 6 years ago! ✨Looks like the überparty can't stop won't stop | 2019-01-10 09:55:29 |
| Pepi | Love the hat! And yes, I intend to keep my level for as long as I can | 2018-12-27 18:34:44 |
| Tarka | / ノ) ) ヽ ゙/ | (´・ω・`)ノ⌒(ゝ._,ノ Oh look it's Xmas again! / ノ⌒7⌒ヽーく \ / 丶_ ノ 。 ノ、 。|/ `ヽ `ー-'_人`ーノ 丶 ̄ _人'彡ノ ノ r'十ヽ/ | 2018-12-24 20:05:36 |
| Tarka | Nice lvl | 2018-11-28 22:55:19 |
| blardo | Hey man, just wanted to let you know I'm still alive!!Anyhow, I just wanted to say that I still love you my man, and miss our talks. Stay safe papi! | 2018-07-01 13:09:22 |
| mimoonet | <3 | 2018-01-25 15:21:24 |
| Tarka | 5 years wow.. It's good to know ya, le secret baguette agent 007, general senpai of Preston, saviour of settlements, Tali fanboi, Stannis the Mannis supporter and best sniper when drunk hue . | 2018-01-10 15:22:16 |
| Mr.Munch | Merry Christmas you beautiful bastard!!! :D | 2017-12-26 00:38:51 |
| Tarka | ∧_∧(。・ω・。)つ━☆・*。⊂ ノ ・゜+. しーJ °。+ *´¨) .· ´¸.·*´¨) ¸.·*¨) (¸.·´ (¸.·'* tits | 2017-12-07 14:34:41 |
| Pepi | pffff xDD That's true though | 2017-11-18 12:22:48 |
| LadyCookieKiller~ | What do boobs and toys have in common? They were both originally made for kids, but daddies end up playing with them. | 2017-11-17 13:28:07 |
| Cyan | This Pepi is kitty-sponsored (•̀ω•́)و ̑̑ | 2017-07-16 20:13:26 |
| blardo | Hey Pepi, long time no talk my fella, Hit me up sometime, been playin' Payday 2 lately so maybe we can do a heist together,Remember, You don't get to just walk away, lady. Unlike Conrad, I actually know how to use a gun | 2017-02-04 17:59:09 |
| Tarka | Es ist 4 Jahre her, mein Doctah! ✨ \o/ | 2017-01-10 13:50:06 |
| blardo | ˛˚˛*˛°.˛*.˛°˛.*★˚˛*˛°.˛*.˛°˛.*★*★* 。*˛.˛°_██_*.。*./ ♥ \ .˛* .˛。.˛.*.★* *★ 。*˛. (´• ̮•)*.。*/♫.♫\*˛.* ˛_Π_____.♥ ♥ ˛* ˛*.°( . • . ) ˛°./• '♫ ' •\.˛*./______/~\*. ˛*.。˛* ˛.*。*(...'•'.. ) *˛╬╬╬╬╬˛°.|田田 |門|╬╬╬╬╬*˚ .˛¯˜"*°••°*" ˜¯`´¯˜"*°••°*"˜¯` ´¯˜"*°´¯˜"*°••°*"˜¯`´¯˜"*°•*´❄`*•.¸.•*´❄`*•.¸.•*´❄`*•.¸.•*´❄`*•.¸.•*´❄`*•.¸.•*´❄`*•.(☆✦✦ℳerry ℭhristmas & a ℋappy 2017!✦✦*☆ )*•.✩.•*´*•.✩.•*´*•.✩.•*´*•.✩.•*´*•.✩.•*´*•.✩.•*´*•.✩.•* | 2016-12-26 15:20:58 |
| Pepi | Nice hat! | 2016-12-26 14:53:16 |
| Tarka | / ノ) ) ヽ ゙/ | (´・ω・`)ノ⌒(ゝ._,ノ Oh look it's Xmas ! / ノ⌒7⌒ヽーく \ / 丶_ ノ 。 ノ、 。|/ `ヽ `ー-'_人`ーノ 丶 ̄ _人'彡ノ ノ r'十ヽ/ | 2016-12-26 13:39:01 |
| ☆Fat Bad Why-Wolf | Merry Christmas, Pepi! | 2016-12-25 02:47:03 |
| Pepi | J'ai vu ça sur ton screen mais j'ai pas compris | 2016-12-11 19:19:08 |
| Nubias | ... ? ... ... ... ! ...... ... ... ! ... ... ... ...... ... ... ... ? ... | 2016-12-11 19:02:41 |
| blardo | hmu dad ;))) | 2016-09-27 07:15:42 |
| Tarka | I know that kitty is sinning right meow. | 2016-05-21 19:54:36 |
| Tarka | ⁽⁽◝( ◕◡◕ )◜⁾⁾ up₍₍◞( ◕◡◕ )◟₎₎ down₍₍ ◝( ˵ ͡ᵔ ͜ʟ ͡ᵔ ˵)◟ ⁾⁾ wiggle your donger around | 2016-03-30 11:38:46 |
| LadyCookieKiller~ | Nah you're probably right, the fight would be too long and rough anyway! | 2016-03-18 12:53:25 |
| Pepi | I don't know... it might be too hard to counter them and I don't want to pull a boner and regret it. | 2016-03-18 12:42:02 |
| LadyCookieKiller~ | Do you have the balls to challenge that army? They're bad to the bone(r) ! | 2016-03-18 12:25:44 |
| Pepi | This is what I call... errecting a lenny army | 2016-03-18 12:11:33 |
| Toaster | Good evening sir. | 2016-01-26 12:05:29 |
| Tarka | RESTON | 2016-01-23 11:33:48 |
| Tarka | who could have known (♥‿♥✿)but I've got something different for you, there's another settlement that needs your help! | 2016-01-10 09:29:07 |
| Pepi | Though it changed from a uber party to a fallout hancock party in 3 years | 2016-01-10 06:46:12 |
| Tarka | 3 years since my first überchain experiment with zhe help from dis Doctah über party | 2016-01-09 18:01:42 |
| Pepi | what the ♥♥♥♥ Jennifer x'DDDD | 2016-01-01 07:48:14 |
| LadyCookieKiller~ | ey, sorry I saw your profile and I just thought you looked cute in your picture, I really wanted to tell you that)) It's really rare to see girls playing video games haha! I don't know why its a guy thing honestly im like really against misogyny and like ill be the one in the kitchen making sandwiches. We should really play l4d2 sometime its a really cool zombie game with a lot of scary moments, but don't worry ill be there to protect you ;) sorry that wasnt flirting I swear Im just trying to be friendly I really like your profile picture sorry was that too far? Really sorry i'm really shy I don't go out much haha add me on skype we should talk more you look really nice and fun xxx | 2016-01-01 07:35:44 |
| Tarka | /フフ / ノ) /\ / | (゚ω 。 7/ ノ⌒7⌒ヽーく丶_ ノ ノ、\ `ヽ `ー-'_人\ 丶 ̄ _人| /`ヽ _/\/ IT'S XMAS TIME! | 2015-12-24 10:00:59 |
| blardo | " You're a wizard, Pepi.. " | 2015-11-13 14:42:30 |
| panda | Meow meow! | 2015-11-12 06:28:06 |
| Tarka | I didn't DeWitt (っ ͡° ͜ʖ ͡° ς) | 2015-11-10 20:05:51 |
| Pepi | XDYou tried 7 times to make this? xD wow, such dedication xDDI'm touched x'D | 2015-11-10 19:27:19 |
| Pepi | Wow! You did well! Steam noticed you, and *I* noticed you! So proud! | 2015-11-06 07:44:23 |
| panda | MEOW | 2015-11-06 06:47:20 |
| Pepi | You did not meow loud enough because steam didn't even heard you nor noticed me! Try again! | 2015-11-06 06:19:01 |
| panda | Meow | 2015-11-04 15:01:00 |
| blardo | Wait, just skip to 0:30 and you're done, just a pooping sound afterwards. | 2015-10-31 18:30:31 |
| Pepi | GOD NO EVERYBODY GO AWAY FROM THIS PROFIL | 2015-10-31 18:28:16 |
| blardo | https://www.youtube.com/watch?v=XJXoAMePQ2Q Pepi got exposed, for the third time.. yay. | 2015-10-31 18:27:47 |
| Pepi | Copy >>> PasteIZ TOO HARD >:D | 2015-10-31 18:27:38 |
| blardo | DAMNED ITFFS THIS IS HARD | 2015-10-31 18:27:13 |
| Tarka | . (・ω・` ) /⌒' ~ `) ( く ノ | イ ヽ,_'ァ , .| ノヽ☆._λ_ ) no. ./ ノ| ノ ( -く |ー( \ └,.| .) ,┘/ (__) | 2015-10-29 21:16:42 |
| Pepi | STOP FLEXING LITTLE TARKA Seriously stop it | 2015-10-29 20:32:00 |
| Tarka | ∧_∧_ (´・ω・`) ̄"⌒ヽ / ) ヽ' / 、 `、 γ --‐ ' λ. ; f 、 ヾ / ) ! ノヽ、._, '`"/ _,. '" | ̄`ー-`ヽ 〈 < _ ヽ. !、__,,, l ,\_,ソ ノ 〈'_,/ / / | 2015-10-29 20:26:28 |
| blardo | OH NO YOU DIDN'T, I would look like the kid whenever she's like talking me.. | 2015-10-27 11:10:53 |
| Tarka | /⌒ヽ / ° ω° \ _ノ ヽ ノ \_`/ `/ ⌒Y⌒ Y ヽ( (三ヽ人 / || ノ⌒\ ̄ ̄ヽ ノヽ___>、___/ |( 王 ノ〈 /ミ`ー―彡ヽ / ヽ_/ |" | 2015-10-26 12:00:37 |
| Pepi | Tarka why you do this >:c | 2015-10-26 11:58:38 |
| Tarka | /フフ ム`ヽ/ ノ) ᴅᴏ ᴜ ᴇᴠᴇɴ ʀᴀɪsᴇ? ) ヽ/ | ༼ຈل͜ຈ༽ノ⌒(ゝ._,ノ/ ノ⌒7⌒ヽーく \ /丶_ ノ 。 ノ、 。|/........`ヽ `ー-'_人`ーノ..........丶 ̄ _人'彡\.............\ 彡 _人彡l..............\____B======================================================D............./____/\____\ | 2015-10-26 11:57:23 |
| Pepi | I fapped to this ( ͡° ͜ʖ ͡°) | 2015-08-15 08:59:53 |
| Nubias | WHAT A THRILL https://youtu.be/duDLXeC2fLg | 2015-08-13 22:41:47 |
| Pepi | That's.... oh :'OI'm speshul too then ;w;You... you're a good person aren't you? :'D | 2015-07-05 19:40:01 |
| panda | it's your profile so it's special! | 2015-07-05 16:16:08 |
| Pepi | I actually just changed my profil on public because I knew you would come take a look, though it's not anything speshul like yours ;3 | 2015-07-05 16:13:44 |
| panda | Oh, now I can see your profile! Anyway, I just wanted to thank you for the very nice and kind comment :3 | 2015-07-05 15:43:39 |
| Pepi | Thanks buddy! | 2015-06-26 14:32:56 |
| Cyan | Looking good, cowboy! | 2015-06-26 14:26:28 |
| Tarka | just found a better one in quality hah | 2015-06-19 11:20:05 |
| Pepi | x'DDDI can't say I was expecting this... and I saw you needed 2 attemps to write it ha x'D | 2015-06-14 17:54:06 |
| ☆Fat Bad Why-Wolf | That was epic XDDDDD | 2015-04-15 20:15:51 |
| Pepi | My friend said "tough tits" to me and I thought she was calling me like that or insulting me xDI didn't know it was an expression and I changed my name after this confusing discussion xD | 2015-04-15 19:15:18 |
| ☆Fat Bad Why-Wolf | Pepi. Your nickname. WHY?! XDDDDD | 2015-04-14 22:33:08 |
| ☆Fat Bad Why-Wolf | Oui, mon ami~ | 2015-03-23 07:22:20 |
| Pepi | Danke, Kamerad!See how good my russian is--wait, wrong tf2 class quote. | 2015-03-23 06:56:19 |
| ☆Fat Bad Why-Wolf | Late Happy Birthday to you, Pepi! | 2015-03-22 23:04:56 |
| VelociRapi | Happy Birthday mate | 2015-03-22 16:34:18 |
| Pepi | (ノ◕ヮ◕)ノ*:・゚✧ Thank you !!! | 2015-03-22 16:09:39 |
| LadyCookieKiller~ | ・゚*\(ᐛ)/*:・゚Happy Birthday Pepi!!!! | 2015-03-22 08:58:13 |
| Pepi | ah on dirat vraiment une paire de fesse avec un string violet ha ( ͡° ͜ʖ ͡°) | 2015-02-15 14:05:49 |
| Pepi | wtf nubias! My profil was FANCY and had FUNNY WEIRD GUY dancing, and now I have kupo kupo and weird video on my profil?Well, it can't harm | 2015-02-15 14:04:58 |
| Nubias | Kupo kupo-kupo kupopo kupoku pokupo kukupoku kupopopo Poku ? -Kupo https://www.youtube.com/watch?feature=player_detailpage&v=Xg4W3PwYOpA#t=35 | 2015-02-14 21:41:13 |
| Pepi | The most important überchain of my life ;w; | 2015-01-10 14:40:18 |
| Tarka | 2 years ago, I lost my chainüber virginity <3 | 2015-01-10 08:00:34 |
| Pepi | - THE DIAMOND IS MINE-- OH ♥♥♥♥, THE DRILL IS STUCK >:C et nooooooooooooon, je veux pas cette musique sur mon compte x'DJe la supprimerai peut être plus tard x'D | 2015-01-02 11:28:21 |
| ChiL | Shepard bright like a diamond !! | 2015-01-02 05:38:29 |
| Nubias | YOU'RE BEAUTIFUL LIKE A DIAMOND IN THE SKY | 2015-01-02 05:36:04 |
| ChiL | https://www.youtube.com/watch?v=lWA2pjMjpBs | 2015-01-02 05:34:52 |
| Tarka | Shepard. | 2014-12-30 19:56:03 |
| Pepi | ☜( ͡~ ͜ʖ ͡° ☜) | 2014-12-28 07:07:17 |
| Tarka | at first I was like ( ͡° ͜ʖ ͡°)...but then I was like (☞ ͡° ͜ʖ ͡°)☞ | 2014-12-27 16:07:21 |
| Pepi | And I'm okay with that ( ͡° ͜ʖ ͡°) | 2014-12-27 09:15:55 |
| Tarka | I know your dirty little secret. ( ͡° ͜ʖ ͡°) | 2014-12-26 21:05:29 |
| Pepi | So pretty :O | 2014-12-25 12:37:58 |
| Pepi | I bet you are Tarka! I wanted to give it to you but.. OHWELL.!!!!!!!!!!! | 2014-12-24 21:29:36 |
| Tarka | OHMYGODI'm totally not jelly for this background | 2014-12-24 10:07:01 |
| Acme | DEMOSPAM! | 2014-12-23 14:25:05 |
| Pepi | Thanks! | 2014-12-22 09:18:04 |
| ☆Fat Bad Why-Wolf | Your nickname is perfect! | 2014-12-19 20:31:52 |
| ☆Fat Bad Why-Wolf | It's KGB style | 2014-11-20 21:00:58 |
| Pepi | x'DDDThanks Wolf xDI never expect you when you come, you're right xD | 2014-11-20 20:10:07 |
| ☆Fat Bad Why-Wolf | OMG! Pepi! Congratulations on Borderlands 2! :'D | 2014-11-20 20:00:24 |
| Pepi | Merci >:D! J'avais aussi remarqué pour les 666heures! Et borderlands 2 est l'un des 2 seuls jeux que j'ai complété a 100% ! | 2014-11-20 19:47:59 |
| Dolu | Fais attention tu as 666 heures de jeu sur Borderlands 2, Le démon habite ce jeu !!!(J'avais pas vu que tu avais tous les succès, joli ! ) | 2014-11-20 02:30:08 |
| ☆Fat Bad Why-Wolf | I'm the Pokemon Master! Deal with it | 2014-08-30 21:53:38 |
| Pepi | *Wolf throws pokéball and hit Pikachu in the face*It's super effective | 2014-08-30 14:04:21 |
| ☆Fat Bad Why-Wolf | Pikachu, I choose you! | 2014-08-29 21:54:12 |
| Tarka | buttburgers | 2014-08-10 04:50:12 |
| ☆Fat Bad Why-Wolf | Rawr here is a fat dinosaur for you | 2014-08-06 11:02:30 |
| Pepi | That's a correct thinking!There was probably a disturbance in the force that happened in the past... it's harmless though. Nothing to worry about 6 months later. You'll be fine. | 2014-07-12 16:48:33 |
| Marty | I thought we were friends. | 2014-07-12 14:39:59 |
| Nubias | C'est ce que j'étais en train de penser xD | 2014-06-26 12:04:04 |
| Pepi | Ton dernier message aura l'air bizzare quand on aura changer de pseudo et qu'on ne sera plus dans le délire xD | 2014-06-26 11:48:00 |
| Nubias | OMG YOU'RE SO CUTE, LET'S SPREAD OUR COLORS AND MAKE THIS WORLD A BETTER PLACE ! | 2014-06-26 08:38:39 |
| Nubias | I must tell you a SECRET !DOBEDOBYDABADABADIDA !TITIKIDOBOTI IT'S A SECRET ! http://youtu.be/zwZISypgA9M | 2014-06-24 21:26:43 |
| Pepi | c: | 2014-06-08 17:10:23 |
| Lunacinda | Thank you, glad you enjoy them | 2014-06-08 15:24:58 |
| ☀Akane Chiasa☀ | Well, that day was one of the most funniest and enjoyable moments I had, and if you're willing to add me back we could play TF2 pubs together, I don't really mind lately c: So that said, I'm glad you too enjoyed our time playing together ^.^ If anything else needs to be said, I say it would be that I hope we can play together again sometime. I'll be waiting if you accept my friend request again, to revive those moments if you're willing to ^.^ | 2014-06-05 06:47:20 |
| Pepi | I do remember your name as I remember the names of every single players I played with and were in my friendlist at least a little while. We indeed met in an mvm match, and we did exactly played one game. After that game, you added me on steam as I was THAT awesome.Though, we chose different path in life... you chose the mvm path, while I chose the normal TF2 pub path, and then when the sun went down a few nights later I had the terrible responsability to keep you in my friendlist or delete you forever wihtout any chance to turn back on you...This was an extremely important moment in my steam life and I decided to keep walking without turning back, and then I deleted you while the wind was passing through my windows and made all the papers in my room flew away. I'll never forget this moment. | 2014-06-05 06:26:49 |
| ☀Akane Chiasa☀ | I randomly found your name in one of my screenshots. I don't recall having you, or maybe I've forgetten your name... but I'm pretty sure we met in a MvM server xD | 2014-06-05 05:59:00 |
| beears baer signage | Thankya | 2014-05-19 20:28:38 |
| Nubias | "I KNOW IT SAYS OMELETTE BUT I THOUGHT IT HAD SOME DEEPER MEANING IN FRENCH" Rofl xD | 2014-04-27 09:25:13 |
| Pepi | Trust me, you don't want to share an omelette with that woman. http://rikkochan.tumblr.com/post/63391000243/madamepapercut-catbountry-moriarty-oh-my | 2014-04-27 05:03:29 |
| Nubias | We should totally share an omelette someday. | 2014-04-26 17:12:34 |
| Pepi | Thanks Fanni, that's a nice comment! I'm very glad to see just after a normal dicussion I had on my profil for once x'D | 2014-04-26 15:32:23 |
| fanni | omlette du fromage | 2014-04-26 14:17:44 |
| Nubias | J'aurais pas grand chose à mettre dessus mais j'y penserai xD | 2014-04-26 11:53:05 |
| Pepi | wa classe! Tu devrais enfin te creer un tumblr pour pouvoir le partager ou un truck du genre :DIz good! | 2014-04-26 10:36:50 |
| Nubias | Yup, merci ^o^, j'avais commencé à la souris et après j'ai branché la tablette :p http://i.imgur.com/nHB8Jgl.jpg + http://i.imgur.com/3kIwjRO.png Il me reste tout le corps à finir :p | 2014-04-26 09:58:42 |
| Spaceman | I have returned from the dead | 2014-04-22 16:33:52 |
| fanni | ALL HAIL TO THE POTATO KAMI-SAMA https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-prn2/v/t34.0-12/1964787_429133780564193_371487890_n.jpg?oh=f5aa3b84b6b496bb65a3910fcf215de1&oe=533BBDB1&__gda__=1396432028_f0ef97dbd0e46839b3915fef9818c3b9 | 2014-03-31 10:38:09 |
| Pepi | oh crap, potatoes everywhere! | 2014-03-31 04:57:31 |
| Nubias | Converted myself, must praise new god. | 2014-03-30 16:17:15 |
| Nubias | Pour me faire pardonner ~♥ http://i.imgur.com/keMuqIB.jpg | 2014-03-29 13:39:17 |
| fanni | C: <3 | 2014-03-16 20:30:41 |
| Nubias | OMFG xD, I never asked for th- Oh wait, I did. | 2014-03-09 14:56:44 |
| Nubias | A ticket to Buttlands pls, must go in Buttlands quick. | 2014-03-08 18:49:59 |
| Pepi | Bloody Spy!! *!* | 2014-01-12 09:24:59 |
| ☆Fat Bad Why-Wolf | Gentleman! | 2014-01-10 21:22:04 |
| Pepi | Me too mate! | 2013-12-25 07:50:41 |
| Tarka | I love you man | 2013-12-25 06:36:49 |
| DavidVegas | DAT PIC xD | 2013-11-30 12:26:27 |
| Tarka | dat avatar | 2013-11-30 10:43:41 |
| Pepi | Vhen ze Hydro voke up, his skeleton vas missing, and ze doctor vas never heard from again! | 2013-10-06 09:05:05 |
| HydroKGB | Hydro was here :D | 2013-10-06 08:44:46 |
| Nubias | Putain j'arrive pas à battre ce boss http://www.youtube.com/watch?v=BVANMRLzQPI | 2013-09-11 15:14:21 |
| Pepi | Ok j'ai pas résisté au coup de la trompette xD!!!! | 2013-09-02 15:04:44 |
| 76561198013681816 | http://www.youtube.com/watch?v=fQO2Opzvyeg&feature=youtube_gdata | 2013-09-02 13:59:25 |
| Nubias | http://www.youtube.com/watch?v=rS88kh--Z8Y *BEEP* *BEEP* *BEEP* *BEEP* *BEEP* *BEEP* *BEEP* | 2013-08-08 18:35:50 |
| Dolu | Dat avatar | 2013-07-18 09:04:22 |
| Cats | if this man had a toe for every good thing he did to the world he would have, atleast, 8 toes | 2013-06-25 19:30:51 |
| Pepi | Mini Boci !!! <3 | 2013-06-25 10:49:03 |
| Boci | Here he comes. :D | 2013-06-25 10:48:28 |
| Spaceman | Mwhaha >:D | 2013-06-25 08:01:11 |
| Pepi | KBEEEEEEEEMMMMMMMMMMMMMM.STICKY TRAP >:Det pourquoi pas j'y ai pas encore réfléchi cette année, mais on peut en discuter | 2013-06-25 08:00:25 |
| Nubias | Pepette Japan Expo ? :O (désolé pour l'année dernière, j't'expliquerai si on se voit) | 2013-06-25 07:58:58 |
| Spaceman | *Activated demoman class, pop * | 2013-06-20 14:58:46 |
| Dolu | Deal with it | 2013-06-20 08:08:17 |
| Pepi | J'ai pas celui là | 2013-06-20 08:05:46 |
| Pepi | :D | 2013-06-20 07:54:05 |
| Spaceman | *Places a here* >:D | 2013-06-20 07:47:13 |
| Dolu | Je suis pauvre, j'ai plus de pepette | 2013-06-13 06:27:53 |
| Cats | nice catpaper m888 | 2013-05-23 10:45:51 |
| Jack | No idea why you were tagged in that screenshot, heh. Anyway, hi. | 2013-04-10 06:52:03 |
| Cyan | Oh my, who's dat handsome fellow in your avatar? ;D | 2013-03-21 19:01:17 |
| Pepi | No, if I hear your voice one more time saying my name, I'll kill myself! | 2013-03-21 17:44:26 |
| Cats | Maybe a birthday song? | 2013-03-21 17:28:46 |
| Cats | Can I sing for you, just a little bit more? | 2013-03-21 17:28:37 |
| 76561198013681816 | http://www.youtube.com/watch?v=Te4wx4jtiEA sa faisait longtemps ;) | 2013-03-13 13:04:25 |
| Cats | YOU HID IT | 2013-03-11 19:43:34 |
| Pepi | Indeed, it almost feels that it was made just for me . Crazy! | 2013-03-08 10:50:39 |
| Cyan | That's one good lookin' avatar you got yourself there ;D | 2013-03-07 21:13:41 |
| LadyCookieKiller~ | Best description I've ever seen!"~GentlecatI'm not really a cat.France" | 2013-03-07 09:17:08 |
| Cats | UMM AAEEM UM... AAAAH! *leaves* - Pepette 2013 | 2013-03-06 12:12:32 |
| LadyCookieKiller~ | Salut cher ami. Juste pour que vous le savez, j'ai vraiment profiter de nos jeux. La prochaine fois, permet de ne pas laisser passer des semaines entre okey?J'aime parler français, im so good à elle: o * Google grèves traduire à nouveau, mais chut *Okey, je vais arrêter maintenant donc je ne vous embarrase trop, 3Vive ~ | 2013-02-01 02:05:50 |
| blue | Pepette! Sorry my french friend for not being on, having computer problems! Havr fun with pomf et Thud ;) Say hi to Day9! ^_^ | 2013-01-26 04:18:51 |
| Tarka | I'm really glad that I was your medic-mate, Thank you for teaching me the chain über. I had so much fun. :D | 2013-01-11 05:39:13 |
| Acme | SPAM SPAM SPAM EGG SAUSAGE and BACON SPAM | 2013-01-08 11:44:25 |
| ChiL | A SPAM IS A SPAM ! WHAT ELSE ! | 2013-01-06 11:18:34 |
| Daxtor | A gentleman amongst traders. Ask him about 'chapeau' or 'crate king' for a cheap Bill's hat!! Also a great friend, have all my +rep! | 2013-01-06 11:14:10 |
| Acme | Bonne Année 2013 Adrien!! Et surtout n'oublie pas G-P-O! | 2013-01-01 11:11:12 |
| LadyCookieKiller~ | And im so glad you added me! I gotta admit, i was a little shy at first and quite scared of you :3 but you truly are a great friend and an amazing player!I too, hope we get to have some fun in 2013! Happy New Year Pepette!! :3 | 2013-01-01 06:50:19 |
| LadyCookieKiller~ | c'est une phrase française, traduite dans Google translate. Ça vous plaît? | 2012-12-31 19:20:01 |
| Sandouish | Yop, comment va :) | 2012-11-29 11:12:25 |
| ЯF™ | Loki.pique | Zblah (ben ... Parceque ça faisait longtemps...) | 2012-10-25 23:32:43 |
| VeX | Blasto!: And thanks for the game and all the random links x)Blasto! is currently offline, message cannot be sent.Blasto! is currently offline, message cannot be sent.Blasto! is currently offline, message cannot be sent.Blasto! is currently offline, message cannot be sent.Blasto! is currently offline, message cannot be sent.Blasto! is currently offline, message cannot be sent.Blasto! is currently offline, message cannot be sent.Blasto! is currently offline, message cannot be sent.Blasto!: Any last word?Blasto!: You seem to be writing something. | 2012-09-06 18:14:46 |
| VeX | Blasto! is now Offline.Blasto!: I'm tired with all thoose randomness..Blasto! is currently offline, message cannot be sent.Blasto!: Goog night.gnite lol | 2012-09-06 18:12:31 |
| Peaceful Garrus | Spam :D | 2012-08-30 08:09:09 |
| baMMM | Howdy partner ! | 2012-08-05 11:58:39 |
| Acme | http://9gag.com/gag/4792652 | 2012-07-18 14:36:22 |
| Nubias | Melfice d'accord, Melfice content =D | 2012-07-04 06:28:48 |
| Grizmu | Never forget to calibrate. | 2012-05-09 08:38:21 |
| 76561198013681816 | http://www.youtube.com/watch?v=wMMmVxxNmG4 ce n'est pas des chats mais c'est tout aussi marrant lol ^^ | 2012-05-03 14:25:02 |
| √ | Damn that's one creepy picture. | 2012-03-26 18:02:10 |
| ChiL | pepette t'es incroyable omg!!!!!cuire cuire moustache!!! | 2012-03-25 06:37:17 |
| 76561198013681816 | http://www.youtube.com/watch?v=HBfy_kjkt4I&feature=share | 2012-03-14 06:08:25 |
| 76561198013681816 | http://www.videobash.com/video_show/dogs-bark-jingle-bells-229379 ce n'est plus d'actualité mais ça ma fait sourir lol | 2012-03-08 09:59:53 |
| ptr | Dsl on c'est mal comprit je pense, on vs propose un match dimanche 21hoo sur notre serveur ;) Vous pensez etre dispo ou pas? | 2012-03-03 13:33:30 |
| 76561198013681816 | http://www.youtube.com/watch?v=nn2h3_aH3vo&feature=related | 2012-02-10 13:05:30 |
| VeX | No! I'm still bad xD | 2012-02-10 12:51:31 |
| 76561198013681816 | http://www.youtube.com/watch?v=vLpb3Rhc_1o&feature=related | 2012-02-07 15:06:25 |
| 76561198013681816 | http://www.youtube.com/watch?v=ICuqGPlY4r0 | 2012-02-07 15:02:16 |
| √ | Capt'n Pepette: Careful, it might be a spy ;)Capt'n Pepette şu an Çevrimdışı.I like how you go offline suddenly after your sentence :P | 2012-01-25 18:00:14 |
| Toaster | T'es un vieux gay avec des poils sur les pieds :D | 2012-01-25 03:30:22 |
| Saufkumpel | Nah, I had to buy some stuff. :D Also: Happy New Year! ^.^ | 2011-12-31 18:19:25 |
| Cyan | Ah Pepette, you are my favourite patient. Enter into 2012 safely, mein friend! | 2011-12-31 11:00:36 |
| √ | Exactly >:3 | 2011-12-26 07:40:22 |
| Pepi | www.everyone-send-me-videos.com | 2011-12-14 13:12:09 |
| Kornichon-Kasqué | http://fr.evilox.com/videos/hardcore-gamer | 2011-12-10 04:22:28 |
| Nubias | http://www.youtube.com/watch?v=TXvMNnJHL_4 | 2011-11-30 21:27:32 |
| 76561198013681816 | http://www.videobash.com/video_show/curious-kitten-6898 | 2011-11-09 12:14:34 |
| √ | As you are :3 | 2011-11-06 18:29:44 |
| MickaelB | Merci pour ce "cassage de dents". On remet ça quand tu veux. | 2011-11-03 19:22:49 |
| Pepi | Tout comme toi mimoonet :D | 2011-10-23 14:41:43 |
| mimoonet | Rhoooooooo les pitits chats !!!!!!!! COmme cé meugnon !!!! | 2011-10-23 08:36:03 |
| 76561198013681816 | http://www.youtube.com/watch?v=Tw2lVRsGEls&feature=related doudou :) | 2011-10-14 16:30:02 |
| 76561198013681816 | http://www.youtube.com/watch?v=99G_7cW1Pxs&feature=related jupiter bébé lool | 2011-10-14 16:14:45 |
| 76561198013681816 | j'ai jamais vu un chat comme ça xd http://www.youtube.com/watch?v=ctJJrBw7e-c&feature=related | 2011-10-14 15:58:49 |
| √ | This is getting awkward. | 2011-10-13 16:18:38 |
| VeX | Mr.PePeTTe: Pepette est un gars formidable et incroyable <3Nope.exe...I AM :3 | 2011-10-13 03:21:36 |
| Pepi | Incroyable :D | 2011-10-11 12:12:46 |
| Sandouish | Je suis là :) | 2011-10-11 11:18:07 |
| √ | And in time, you will be able to see inside of my eye. I WILL DO IT! | 2011-10-06 14:25:44 |
| Fanotak | Si tu publies sur ma page, eh bien il se passe...........NATHING! 8D ah, si, je répond. | 2011-10-02 16:16:28 |
| VeX | "I don't know what 1+1 means" me neither D: | 2011-09-26 14:29:22 |
| VeX | Return Spam. Just for the sake of returning the spam. | 2011-09-21 03:47:47 |
| 76561198013681816 | Aujourd'hui, je me suis fait larguer par ma copine. Le motif est pour le moins original. "En sortant avec toi, je n'ai pas le temps de jouer à World of Warcraft." VDM | 2011-09-20 11:34:12 |
| Grizmu | Most played class on TF2 : 1°) pro | 2011-09-10 02:37:29 |
| Nubias | Thank you for your reward, kind Sir. | 2011-09-08 16:21:31 |
| Pepi | -Congratulations!-A winner is you! | 2011-09-06 18:39:27 |
| Nubias | FOUND IT! ON THE LAST DAY! THE ♥♥♥♥♥♥♥♥ CUBE! | 2011-09-06 17:22:24 |
| Nubias | Et puis tu trouves bien des PS2/Gamecube/manettes/jeux/cartes mémoires dans la rue, alors tu pourrais m'aider à trouver un foutu cube dans un jeu xD | 2011-09-01 23:15:03 |
| Nubias | J'suis sûr qu'il est caché chez toi. | 2011-09-01 19:24:56 |
| Pepi | Nope, if I lost it, I can't use this image anymore xD | 2011-08-23 11:01:54 |
| VeX | nice hat at your profile image...1ref?xD | 2011-08-22 20:09:05 |
| Trinaume | FREE HAT FOR YOU | 2011-08-22 11:10:23 |
| Pepi | Mais lol, il en rate pas une le melfice! | 2011-08-10 10:39:09 |
| Nubias | You know what, this plan is so good, I'm going to give you a sporting chance and turn off the thunder. I'm joking of course. Goodbye | 2011-08-09 21:42:45 |
| Blasto the Hanar Spectre | I'm peaceful. | 2011-08-08 11:53:52 |
| Nubias | Estás usando este software de traducción de forma incorrecta. Por favor, consulta el manual. | 2011-08-05 11:25:28 |
| Pepi | Nope.avi | 2011-08-04 10:17:45 |
| Nubias | I'm gonna hack your account, but I can't do it if you're watching.Could you just turn over for a few seconds ? | 2011-08-04 06:45:10 |
| Nubias | EST-CE QU'UNE TRAINEE POURRAIT T'ENVOYER DES MESSAGES SUR TON PROFIL STEAM ? HEIN ?EST-CE QU'UNE TRAINEE POURRAIT FAIRE CA ? | 2011-08-04 04:16:24 |
| Nubias | I've been really busy being dead. You know, after you murdered me.Oh look. There is a deer. You probably can't see it. Get closer.Bon sinon à part ça, j'ai enfin ce p'tit bijou mais le net déconne grave là où je suis. C'est un miracle que je l'ai en ce moment, donc j'vais en profiter pour finir ma partie.J'te préviendrai quand tout sera bon pour jouer en coop :p | 2011-08-03 09:22:20 |
| mio | bla bla bla | 2011-07-24 10:27:55 |
| ChiL | TF2 = Duel au soleil !!!!!! | 2011-07-24 06:02:51 |
| Acme | LOL SPAM | 2011-07-04 19:06:41 |
| Nubias | Dun-dun-dun-dun-dun-dun-DUN! DUN DUN! Dunna-dunna-na-dunna-na-DUN! DUN DUN! nananaDUNDUNDUN dun-dun-dun-dun-dun-dunDun-dun-dun-dun-dun-dun-dunna-dunna-na-dunna-na-playing by our own rules-nanana-hanging by our fingers from a mountain-dun-dun-dun-dun-dun-dun | 2011-06-27 12:44:06 |
| Pepi | mims in English! wtf! But thx! | 2011-06-22 14:59:53 |
| mimoonet | waaaooowww you picture is very very beautifull !!! | 2011-06-22 11:05:30 |
| Pepi | <3 | 2011-06-21 11:17:37 |
| Blasto the Hanar Spectre | Mouahahaha-ha! | 2011-06-21 08:04:10 |
| Pepi | TG AQME! J'ai meme pas pu savourer mon 100ème message sur steam enfoiré! | 2011-05-07 05:12:24 |
| Acme | Oh mon petite Chou fleur | 2011-05-06 21:17:35 |
| Acme | Gentlemen? | 2011-05-06 21:17:06 |
| Acme | KA BOOM | 2011-05-06 21:16:17 |
| Acme | Why I could be a spam demoman? | 2011-05-06 21:15:35 |
| Acme | je peux aller sur ton profil a nouvo | 2011-05-06 21:14:46 |
| Acme | DEMO SPAM LOL | 2011-05-06 21:14:27 |
| Cyan | But I don't like deleting your comments, you are the only one writing on my page :c | 2011-05-03 10:28:49 |
| Pepi | NEED A MATE FOR COOP PORTAL 2 | 2011-05-01 11:12:21 |
| Cyan | Ze evil doktor enjoyed working with you! Let's play again some time :] | 2011-03-17 19:20:38 |
| vv | ca s'arrange ton mal de ventre ? | 2011-03-03 15:49:36 |
| Pepi | but I think it's gonna come | 2011-02-27 14:39:27 |
| Pepi | I want some spam :'( | 2011-02-13 19:20:32 |
| Trinaume | ლ(゚д゚)ლ | 2010-12-02 12:25:18 |
| 76561198013681816 | NIJA CAT !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! | 2010-11-15 10:52:47 |
| Nubias | (Enlève l'espace entre le 7 et le 5 è_é ) | 2010-11-15 05:26:06 |
| Nubias | http://static.tvtropes.org/pmwiki/pub/images/darth_vader_nooo_7675.jpeg ლ(゚д゚ლ) | 2010-11-15 05:25:11 |
| Nubias | GIMME DAT COOKIE ლ(゚д゚ლ) | 2010-11-14 07:57:51 |
| Nubias | LIONEL | 2010-11-02 06:13:53 |
| Nubias | LION | 2010-11-02 06:13:39 |
| Nubias | FION | 2010-11-02 06:13:32 |
| Nubias | PION | 2010-11-02 06:13:25 |
| Acme | DION | 2010-09-02 10:21:31 |
| Acme | CELINE | 2010-08-25 16:55:39 |
| Acme | WAITLINE | 2010-08-25 16:55:28 |
| Acme | PIPELINE | 2010-08-25 16:55:18 |
| Acme | PIPLETTE | 2010-08-25 16:55:10 |
| Acme | PIPETTE | 2010-08-25 16:55:03 |
| Acme | PEPETTE | 2010-08-25 16:54:56 |
| chaosBanana | t encore vivant? | 2010-08-22 18:04:31 |
| Pepi | u're welcome. | 2010-08-18 12:25:36 |
| ally-94 | miciiiiiiiiiii mon ti cousin pour le jeux cadeau hihihi!!! ta vu g acheté simcity trop biennnnnnnnnn!!!!!!!!!!! bisouxxxxxxxx | 2010-08-18 11:47:29 |
| chaosBanana | t'a changé ton numero portable? sms a moi stp | 2010-08-14 13:21:57 |
| ally-94 | coucou c moi hihi | 2010-08-14 06:17:16 |
| ClockworkFiction | The cake is a lie | 2010-07-03 19:35:34 |
| Nubias | The Enrichment Center is required to remind you that you will be baked, and then there will be cake. | 2010-06-16 07:36:55 |
| ClockworkFiction | Bonk X3 | 2010-06-15 10:04:18 |
| ClockworkFiction | Bomk X3 | 2010-06-15 10:04:06 |
| Nubias | C-C-C-C-COMBO BREAKER !!! | 2010-06-15 09:18:53 |
| Toaster | En même temps il est 1h51 du mat là. Je me fais chier, il faut bien s'occuper ^^ | 2010-05-21 18:52:15 |
| Toaster | Boarf apres tout je peux toujours essayer :D | 2010-05-21 18:51:36 |
| Toaster | Du coup si j'essaye de faire mieux et que je n'y arrive pas ... | 2010-05-21 18:51:20 |
| Toaster | En faite je viens de voir que en faite je fais minable par rapport aux autres qui te flood :/ | 2010-05-21 18:50:58 |
| Toaster | chanson* (ouais je te flood ta page :p) | 2010-05-21 18:49:15 |
| Toaster | pepette en chandon ? http://www.youtube.com/watch?v=aDrS5NCYEVk \o\o/o/ | 2010-05-21 18:48:45 |
| Toaster | Pepette en chanson ? Voila ce que ça donne :D http://www.youtube.com/watch?v=aDrS5NCYEVk \o\o/o/ | 2010-05-21 18:48:14 |
| B3nZ3n | UNICOOOOOOOORN! <o/ | 2010-05-04 10:12:34 |
| MickaelB | jkiff ton avatar, même s'il ressemble à rien à mes yeux | 2010-04-27 10:20:13 |
| Nubias | ALWAYS I WANT TO BE WITH YOUAND MAKE BELIEVE WITH YOUAND LIVE IN HARMONY HARMONYOH LOVE!!! | 2010-04-25 10:08:14 |
| ClockworkFiction | im board.... | 2010-04-15 19:06:51 |
| Mr IndoBoy | c'est y pas mignonnnnnnnnnnn ! | 2010-04-05 13:42:43 |
| Nubias | Ecouteuh, maman est près de toi, il faut lui direuh "MAMANNNNNNN c'est quelqu'un pour toi" | 2010-03-30 08:54:47 |
| ChiL | SPAM OU MAPS a l'envers enfaite hein hein c'est de la d'ou ca viens !! | 2010-03-12 14:09:36 |
| Mr IndoBoy | genre le retour !!! † † † | 2010-03-08 17:30:22 |
| ClockworkFiction | i have been POW for touhou for awile fuji dosent change it that often | 2010-02-06 13:27:59 |
| Acme | SPAM du 18 janvier | 2010-01-17 17:01:32 |
| MickaelB | look mon singe | 2009-12-28 11:29:23 |
| ClockworkFiction | Demoman FTW | 2009-12-11 13:06:00 |
| MickaelB | avec un sCouT | 2009-12-02 10:34:51 |
| MickaelB | héMEC | 2009-11-29 14:20:30 |
| ClockworkFiction | ya...right. | 2009-10-17 23:47:26 |
| ClockworkFiction | DAM YOU!!!!!!!!! I WANT THAT LOLIPOP | 2009-09-18 19:19:07 |
| ClockworkFiction | You get a lolipop but not me D: | 2009-09-18 12:23:57 |
| Pepi | haha nice to see you like it ;) | 2009-09-07 16:59:01 |
| Pepi | Yurusai kono baka !!! | 2009-08-25 12:49:28 |
| nes | BB-Baaka! | 2009-08-24 05:31:55 |
| nes | In Your Face Pal ! | 2009-08-23 06:42:58 |
| Nico | TA GUEULE ! | 2009-08-11 07:24:11 |
| Nico | TA GUEULE ! | 2009-08-11 07:24:07 |
| Nico | TA GUEULE ! | 2009-08-11 07:24:04 |
| Nico | TA GUEULE ! | 2009-08-11 07:24:00 |
| Nico | TA GUEULE ! | 2009-08-11 07:23:56 |
| Nico | TA GUEULE ! | 2009-08-11 07:23:53 |
| Nico | Ca va, longue journée, mais c'était cool, y a eu deux trois chamelles. Ca va toi à la SNCF ? | 2009-07-20 09:58:27 |
| Acme | bien et toi? | 2009-07-19 14:48:41 |
| Nico | Ca va ? | 2009-07-19 14:46:43 |
| Acme | Salut nico ! | 2009-07-19 14:46:00 |
| Nico | Salut Aqme ! | 2009-07-19 14:45:16 |
| Pepi | :3 | 2009-07-13 10:25:17 |
| Acme | OOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOHOOHHOHOOH | 2009-07-13 07:36:48 |
| Acme | TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement TIens spam made in aqme avec une barre de défillement | 2009-07-13 07:33:44 |
| Acme | Y'en aura pour tout le monde et surtout pour Pepette dans ta gueulle SPAM | 2009-07-13 07:33:07 |
| MickaelB | ici calinou : FPSLOLDOOMMDRPTDRRTSSTARCRAFTHYDRALISKDROPTANKROULEAUCOMPRESSEURDANSTAFACE. fin de message. | 2009-06-08 13:58:45 |
| MickaelB | mon chataignier joue à DOOM et il se porte bien | 2009-06-08 11:08:06 |
| MickaelB | "Les droits de l'homme ET la nature des joueurs de jeux vidéos, en particuliers les FPS " | 2009-06-08 11:07:30 |
| Pepi | vaten mon clone | 2009-06-03 11:55:56 |
| Blasto the Hanar Spectre | you're so awesome ! You must be the most clever guy I have ever seen ! | 2009-06-03 11:48:36 |
| Pepi | Bande de Gay! !! | 2009-06-03 11:41:14 |
| Mr IndoBoy | PyPyTTy | 2009-06-01 16:35:39 |
| Mr IndoBoy | PiPiTTi | 2009-06-01 16:35:22 |
| Mr IndoBoy | Piîpitti | 2009-06-01 16:35:03 |
| MickaelB | pepepepepepeepepTTTe | 2009-05-29 11:13:28 |
| MickaelB | PaPaTTa | 2009-05-29 11:13:17 |
| MickaelB | PoPottO | 2009-05-29 11:13:09 |
| MickaelB | PuPuTTu | 2009-05-29 11:12:53 |
| Mr IndoBoy | bloblobloblobloblobloblobloblobloblobloblobloblo | 2009-05-28 13:48:24 |
| Acme | bLURP BLURP BLURP !!!! | 2009-05-02 15:22:20 |
| Sandouish | Bah j'�tais en vacance pendant 2 semaines et la copine �tait � la maison donc pas de cs ^^'Mais t'inqui�te I'm BACK ;) | 2009-04-27 18:17:59 |
| MickaelB | SPAM INNNNCOMING | 2009-04-15 09:37:21 |