SteamHistory
Alias SearchAvatar SearchURL SearchBulk SearchAPIComment SearchMulti-Source Search
[ Supporter Features ]
Alias SearchAvatar SearchURL SearchBulk SearchAPIComment SearchMulti-Source Search
[ Supporter Features ]
[ Supporter Features ]
[ Supporter Features ]
SteamID64: 76561198179677999
SteamID32: [U:1:219412271]
SteamID: STEAM_0:1:109706135
CommunityURL: https://steamcommunity.com/id/tommyblacktb/
ProfileURL: https://steamcommunity.com/profiles/76561198179677999
Status: Offline
Privacy: Public
Profile Setup: True
Premium: True
Creation: 2015-02-15 07:59:04 (GMT)
Last Updated: 2024-06-24 16:17:53
VAC Banned: False
Community Banned: False
Game Banned: False
Trade Banned: False
| Name | Time Changed |
|---|---|
| Tommy Black 🌸 | 2024-06-24 16:17:53 |
| Tommy Black🌸 | 2024-06-15 14:59:56 |
| Tommy Black💎 | 2024-05-29 20:41:27 |
| Tommy Black 🔫 | 2024-05-24 18:37:40 |
| Tommy Black 🦚 | 2024-05-13 14:13:17 |
| Tommy Black ✂ | 2024-05-07 07:57:36 |
| LEORIO THE GOAT | 2024-04-30 15:42:50 |
| Tommy Black | 2024-04-23 06:52:47 |
| Big Bang Black | 2024-04-20 21:55:47 |
| Big Bang Jiri 🗡 | 2024-04-16 16:30:35 |
| Tommy Black | 2024-04-12 22:07:47 |
| Tommy Black #UFC300 FIGHT WEEK | 2024-04-11 20:14:23 |
| Tommy Black | 2024-04-08 10:44:16 |
| Tommy Black #TeamRock | 2024-04-02 21:27:52 |
| Tommy Black | 2024-04-02 08:04:39 |
| Tommy Black #RIPKeemstar | 2024-04-01 18:46:02 |
| Tommy Black | 2024-01-11 13:16:42 |
| Tommy Black 🍧 | 2023-12-27 11:13:13 |
| Tommy Black | 2023-12-19 17:15:12 |
| Tommy Black #TeamColby | 2023-12-15 22:53:28 |
| 🎄Tommy Black🎄 | 2023-12-03 16:57:30 |
| Tommy Black | 2023-11-23 21:56:09 |
| Tommy BLack | 2023-11-22 20:30:51 |
| Tommy BLack 🎃 | 2023-11-04 13:10:02 |
| Tommy BLack🎃👻 | 2023-10-16 00:17:09 |
| Tommy BLack FIGHT DAY!🎃👻 | 2023-10-14 05:12:43 |
| Tommy BLack🎃👻🕷 | 2023-10-10 17:52:55 |
| 🧛Tommy BLack🧛 | 2023-09-30 19:08:02 |
| Tommy Black🎃🥊 | 2023-09-26 18:05:46 |
| Tommy Black 🎃 | 2023-08-26 18:10:56 |
| Tommy Black | 2023-08-21 12:55:40 |
| Tommy Black 🥊 | 2023-07-30 17:00:39 |
| Tommy Black | 2023-07-13 15:23:56 |
| KING HARAMBE | 2023-07-12 09:54:09 |
| Tommy Black | 2023-06-14 15:41:08 |
| Tommy Black ▲ | 2023-05-29 04:45:29 |
| Tommy Black | 2023-05-12 06:26:01 |
| Super Saiyan Rosé Tommy | 2023-05-10 16:34:47 |
| Super Saiyan Rosé Tommy 🌷 | 2023-05-09 09:10:09 |
| TommyTucker915 🌷 | 2023-05-08 06:36:08 |
| TommyTucker915 🥊 | 2023-05-01 03:01:59 |
| TommyTucker915 🌠 | 2023-04-23 07:03:23 |
| Tommy Black ♛ | 2023-04-18 05:33:48 |
| Tommy Black | 2023-03-31 02:28:55 |
| Tommy Black🌴 | 2023-03-30 03:00:01 |
| RealName | Time Changed |
|---|---|
| Tommy | 2024-06-07 23:06:36 |
| Dustin the💎Poirier | 2024-05-29 20:41:27 |
| Yusuke and Kuwabara | 2024-05-24 18:37:40 |
| Leorio | 2024-05-22 11:13:18 |
| Tommy | 2024-04-26 07:49:04 |
| Samari Jiri > | 2024-04-20 21:55:47 |
| BIG BANG | 2024-04-16 16:30:35 |
| Tommy Black | 2024-04-12 22:07:47 |
| The Final Boss | 2024-04-11 20:14:23 |
| Tommy | 2023-11-04 13:10:02 |
| 𝐓⃥𝐨⃥𝐦⃥𝐦⃥𝐲⃥ | 2023-09-30 19:08:02 |
| Tommy | 2023-09-16 16:57:05 |
| Tommy 🎃 | 2023-09-03 15:33:05 |
| Tommy 🎃 | 2023-08-26 18:10:56 |
| Tommy | 2023-07-30 17:00:39 |
| Goku Black the GOAT | 2023-07-22 16:49:02 |
| Harambe 27th May 1999 - 28th May 2016 | 2023-07-11 19:21:13 |
| Tommy Black | 2023-05-09 09:10:09 |
| TommyTucker915 | 2023-04-23 07:03:23 |
| Tommy Black ♛ | 2023-04-18 05:33:48 |
| Tommy | 2023-04-01 03:12:36 |
| URL | Time Changed |
|---|---|
| https://steamcommunity.com/id/tommyblacktb/ | 2024-04-30 15:42:50 |
| https://steamcommunity.com/id/bigbangjiri/ | 2024-04-16 16:30:35 |
| https://steamcommunity.com/id/tommyblacktb/ | 2023-05-20 12:05:35 |
| https://steamcommunity.com/id/supersaiyanrosetommy/ | 2023-05-10 16:34:47 |
| https://steamcommunity.com/id/tommytucker915/ | 2023-04-23 07:03:23 |
| https://steamcommunity.com/id/tommyblacktb/ | 2023-04-01 03:12:36 |
| State | Time Changed |
|---|---|
| Public | 2024-04-11 20:14:23 |
| Private | 2024-04-11 11:38:59 |
| Public | 2023-09-03 15:33:05 |
| Friends-Only | 2023-09-01 05:53:39 |
| Commenter | Message | Timestamp |
|---|---|---|
| Vencut | Happy birthday! | 2024-06-24 18:07:09 |
| Àchilles | JASON YOU ♥♥♥♥♥♥♥ ♥♥♥♥ | 2024-06-01 08:09:38 |
| Gon | Happy birthday 🗡️ | 2024-05-27 12:39:22 |
| Stings | Happy Birthday to zan's twin | 2024-05-27 09:23:03 |
| Ecco | happy birthday to capybara's number one fan 🎉 | 2024-05-27 08:52:49 |
| lofi kitten | Happy Birthday (even tho you watch dubbed anime) | 2024-05-27 08:10:41 |
| Tommy Black 🔫 | Love you Yusuke | 2024-05-22 12:47:39 |
| Yusuke | Forte abraço meu Amigo | 2024-05-22 12:24:54 |
| Synk | јеби се педеру црњо | 2024-04-03 09:53:06 |
| Unbreakabill | yooo Brock Lesnar??? +rep | 2024-03-19 04:24:39 |
| Jexol | R.I.P to Toriyama-sensei for making works of art that have touched millions of hearts around the world. You will be missed greatly o7 | 2024-03-09 07:58:19 |
| Tommy BLack🎃👻 | Weirdo stalker | 2023-10-18 13:30:06 |
| Struggler | Let it stay that way. Goodbye. | 2023-10-18 13:26:23 |
| Tommy BLack🎃👻 | No idea who you are lmao. Dillon Danis >>> | 2023-10-17 01:06:53 |
| Struggler | You've really let yourself go since the time we knew each other. Who the ♥♥♥♥ has a picture of Dillon Dannis, lmfao. | 2023-10-16 19:49:21 |
| Tommy BLack🎃👻 | FIGHT DAY FOR THE BIGGEST AND BEST BOXING EVENT OF ALL TIME - Dillon Danis vs Logan Paul, KSI vs Tommy Fury | 2023-10-13 18:44:17 |
| Ecco | Happy birthday Tommy 🎉 | 2023-05-27 16:39:17 |
| Stings | happy birthday you neck in a half | 2023-05-27 16:17:09 |
| IJexol™I | Happy Bday. Wish you all the best, man. | 2023-05-27 07:23:55 |
| Tommy Black | yo yo | 2023-05-17 14:36:20 |
| KI7A | Hey yoo | 2023-05-17 13:29:47 |
| TommyTucker915 🥊 | Good games on Undisputed boi | 2023-05-04 07:27:51 |
| TRG Brad | +Rep | 2023-05-04 07:26:33 |
| Tommy Black | It's an insane announcement. Best Dragon Ball news in a VERY longtime | 2023-03-07 20:35:58 |
| IJexol™I | New budokai tenkaichi just got announced. Go super saiyan. | 2023-03-07 18:37:29 |
| Tommy Black | Thanks Minty on a swing | 2023-03-04 03:35:43 |
| Ghostie's Toastie | 10/10 name Bubba's Boyfriend | 2023-03-03 15:41:01 |
| Ghostie | keep the neck | 2023-02-24 10:46:00 |
| WhoKnoWhat | i took some protection hits and got tunnelled off of hook twice XD very entertaining display | 2023-02-15 05:30:14 |
| Cunty | -rep sandbagging at vault | 2023-02-09 05:58:48 |
| Albert Wesker | +Rep great survivor | 2023-02-05 04:17:03 |
| Tommy Black | You were the Blight, right? Easy jukes and loops for myself friend. | 2022-11-14 13:01:13 |
| Conquestrial | tbags after every pallet and then goes down in 5 seconds ggs | 2022-11-14 12:47:21 |
| Tommy Black | I was AFK, sorry | 2022-11-12 06:20:28 |
| jared | -rep did no gens while i looped the killer for 2 mins | 2022-11-12 05:20:00 |
| Purdy | +Rep Wish I was as good as loopin as this guy | 2022-11-11 05:31:53 |
| Tommy Black | I got two kills. I don't see how that makes me bad, but go off Lynzlet | 2022-11-08 05:18:26 |
| Lynzlet | -rep he plays so bad that looks like a bot with bad AI. free win against him. | 2022-11-08 05:14:06 |
| Herlodus | You cucked me you ass... | 2022-11-06 04:45:06 |
| Tommy Black | Happy Halloween | 2022-10-31 09:05:05 |
| Tommy Black | ''AND ALL UR PARENTSAND UR DOGAND UR COUNSINS'' | 2022-10-31 03:25:32 |
| Gloria Hole | useless potato - if you see this c u n t in the lobby - leave. | 2022-10-31 03:21:32 |
| Magical Teddy | +rep, sis ate | 2022-10-29 17:10:36 |
| maDEMOman | i wouldnt need to blame everyone if the devs did their job right. | 2022-10-24 10:29:37 |
| Tommy Black | Maybe you should just not comment on random people's profiles assuming it's 'THAT' person. such a clown | 2022-10-24 09:11:54 |
| maDEMOman | it would help if they made it easier to know which steam account is whos ingame. >_> | 2022-10-23 12:49:34 |
| Tommy Black | Easy game. Killed you all as Frieza. Hiding? That was literally you. HAHAHAH | 2022-10-23 12:29:01 |
| Ymir | bottle of water | 2022-10-11 12:31:54 |
| zLeoC | -rep useless random DCing for no reason, threw the whole match | 2022-09-29 11:38:51 |
| Tommy Black | And the sheer desperation to comment on my profile about it. More salty comments to the list | 2022-07-17 14:35:16 |
| Tommy Black | Correction. You went full Karen at me because I posted a fighterZ gif of Goku Black on the Xenoverse 2 Community Hub. How much of a baby and karen do you have to be to give a s hit what I do? | 2022-07-17 14:34:22 |
| Shotguy | -Rep posting useless **** on the wrong steam community and got angry when someone point it out | 2022-07-17 14:17:19 |
| Tommy Black | Thanks Jim Hopper . Yours is nice too | 2022-06-28 08:30:26 |
| Giancarlo | Nice profile Dude | 2022-06-28 08:24:40 |
| Tommy Black | Returdd letssss goo my boi | 2022-06-23 01:29:08 |
| Leex | Returd is on the house boiiiiiiiiii | 2022-06-22 18:50:20 |
| Tommy Black | Journeyman Jade | 2022-03-12 13:12:31 |
| Jade Bratz | Jade hates you | 2022-02-19 12:23:39 |
| Mr. 91 | My favorite bipolar person | 2021-12-04 19:17:41 |
| i babie | has 2k hours and plays like a meghead | 2021-10-31 13:10:15 |
| Theresa The Choclit Gobbler | I felt creamy when he was looping me around, 10/10 would play again only if he gives me the oozy goopy stuff | 2021-10-24 14:15:35 |
| JEDI DETHKARZ | -rep for being toxic and sfk | 2021-08-04 13:12:01 |
| NeoBlancSouls | +rep Fantastic survivor. | 2021-07-04 08:43:32 |
| Tommy Black | Make a new Bratz game | 2021-05-30 10:02:29 |
| Princess Baddie Jade | Jade's gonna rub her clit on this profile | 2021-05-30 09:58:58 |
| Ghostie | Happy birthday you neek | 2021-05-27 10:33:27 |
| Anorak | Awesome looking profile! | 2021-05-18 09:45:44 |
| Tommy Black | I said Turkish F uck. How does that make me racist? I didn't know you can be racist to a country. + I put +rep so I was clearly joking you wet wipe. | 2021-04-28 10:06:17 |
| _AssassinsCreed_ | link | 2021-04-28 08:27:48 |
| _AssassinsCreed_ | https://steamcommunity.com/profiles/76561198280585438 | 2021-04-28 08:27:41 |
| Tommy Black | Since you're Turkish, I'm guessing you're talking about Leex. and No we both were friends so I don't see how I was racist to him you idiot | 2021-04-28 08:01:22 |
| Tommy Black | On who's account? link me | 2021-04-28 07:02:49 |
| _AssassinsCreed_ | I saw it in my friends profile | 2021-04-28 06:34:23 |
| Tommy Black | I've never seen your profile in my life. so tell me Keskin, how am I racist? | 2021-04-28 05:26:17 |
| _AssassinsCreed_ | racist ♥♥♥♥♥ | 2021-04-28 05:19:50 |
| Shangwi | Award for your profile | 2021-04-24 08:04:45 |
| Shangwi | Spicy profile Bulkatunde | 2021-04-24 07:56:27 |
| ShyBunny | you're a ♥♥♥♥♥♥♥ idiot lmao | 2021-04-04 11:14:22 |
| Limonka | - rep ливнул как только получил хит! м.дак! | 2021-04-03 11:08:20 |
| Tommy Black | badddieeee Zelda going at it | 2021-04-02 08:30:46 |
| Follow theeShiX on Twitch | -rep lil farming slut. dodge this ♥♥♥♥ 1,8k hours and still dont know how to safely unhook ♥♥♥♥♥♥ xD | 2021-04-02 06:33:59 |
| Matt | -rep, tbags and then gets destroyed to the point where he gives up on hook | 2021-03-08 06:19:05 |
| Tommy Black | Aine spitting straight facts here | 2021-03-05 16:05:38 |
| Aine | Killer is not OP but if u are a team player and want to save your mates you try it atleast to help even when the killer is camping just sad people are camping when they get outplayed... | 2021-03-05 15:47:25 |
| Tommy Black | Aww, Someones probably S hit as survivor and doesn't know how to juke. You're a F ucking majorly lost cause if you really think killer is more OP. | 2021-03-05 02:19:13 |
| Stevey The Ex-Eevee | lmao, a camper and they think the game is survivor sided. What a lost cause. | 2021-03-04 19:37:52 |
| Aine | -rep camping hag 1,7k hors still crap in the game stop camping in basement :D | 2021-02-27 06:20:38 |
| Shego | if console really is capped at 30 then console is shi-t lol | 2021-02-25 06:28:47 |
| Shego | 30 fps is ♥♥♥♥ compared to higher frames. i play on umlimited and 125 when available plus use cheat engine speed hacks on single player often. I even at times try and keep up at 500-1000fps on streets of rage remake and watch videos at 2 times speed too | 2021-02-25 06:27:36 |
| Tommy Black | You were probably using a controller, so that already makes the gameplay a whole lot different. + isn't Consoles (PS4 and XBOX ONE) only capped to 30 FPS. so yea, you're playing at a whole new experience on PC. so what r u on about | 2021-02-25 04:08:43 |
| Neko♡ | boy i was on console before dont come at me like that i prob play this game for a longer time then you | 2021-02-25 03:44:55 |
| Tommy Black | You have 200 hours on the game. Say no more sakura | 2021-02-25 03:40:35 |
| Neko♡ | sure you JUKED the killer dear keep telling yourself that i would JUKE the killer too with URBAN EVASION ;) | 2021-02-25 00:44:20 |
| Tommy Black | Awww poor you. At least I actually juked the killer. You didn't do ♥♥♥♥ . you sucked at ''TRYING'' to juke. | 2021-02-24 15:02:31 |
| Neko♡ | -rep is following you while your injured and just got off the hook trying to get the killer to follow you. WORST TEAMMATE EVER | 2021-02-24 15:00:58 |
| Tommy Black | Bratz big bobs | 2021-01-01 05:53:23 |
| Tommy Black | Thank you XENA. tell gabrielle I said Hi | 2020-12-31 12:59:31 |
| Tommy Black | Supp | 2020-12-31 04:16:04 |
| ily | sup | 2020-12-31 03:36:29 |
| Tommy Black | You're sexy | 2020-11-18 05:59:38 |
| Tommy Black | Thanks for making my picture like it is <3 | 2020-11-14 16:04:25 |
| Tommy Black | Love you Katie with the D | 2020-11-14 16:01:46 |
| Shego | Biden was a 3/Kamala Harris his vice was a 5 and Trump was a 9 but keep in mind this was out of 24 too and not 10 in being closer to my own ideals that is | 2020-11-07 08:57:42 |
| Shego | If Biden wins? He is old. So he can literally have like a heart attack and we get his vice which would become our first woman prez if something like that would happen. According to my oracle his vice is higher in being closer to my ideals than Biden is but Trump is even higher than her and Biden | 2020-11-07 08:55:52 |
| Tommy Black | And it seems like Biden might win this election. R.I.P Trump. | 2020-11-05 02:37:10 |
| Tommy Black | And you can fight me at whatever you want, unless it's changing the game for me lol | 2020-11-05 02:36:11 |
| Tommy Black | I don't mind talking politics. You can go ahead | 2020-11-05 02:35:44 |
| Shego | Maybe I just fight you at like 90 to 120 your too good lol | 2020-11-04 19:26:14 |
| Shego | Well in my ideal you could fight me at the normal 60 fps on your end while I fight you where both our characters are like 240 so I get what I want and you get what you want. | 2020-11-04 19:25:13 |
| Shego | Do you mind talking politics on your steam profile Tommy? I know Zelda hates so I stopped on hers. | 2020-11-04 19:23:33 |
| Tommy Black | no katia. go suck on chewing gum you T******** | 2020-11-04 10:53:51 |
| Φ Aaron | ♥♥♥♥♥♥♥ surv noob | 2020-11-04 08:18:04 |
| HITCH LEW 62 | give me a kiss | 2020-11-04 07:25:56 |
| Tommy Black | Also do you remember Donald when you had food poisoning and you were S hitting everywhere in the library? You poor man | 2020-11-04 06:23:38 |
| Tommy Black | I prefer Xenoverse how it is tbh. there is no need for extra speed lmao | 2020-11-04 06:22:11 |
| Shego | This would spice the game up quite a bit. If this was official from Dimps and Bandai Namco.If you love Dragonball Z why wouldn't you love speed? Or this? If you love Dragonball Z why wouldn't you love speed? Or this? If you love Dragonball Z why wouldn't you love speed? Or this? This repetition isn't just for sillyness. I really want this to happen | 2020-11-04 03:11:28 |
| Shego | xenoverse 3 with speed settings themselves and played the game as fast as you can you could release that to the public. Which would be great cause of many reasons. I could only keep up with xv2 at 240 fps I think currently. There would still be cheaters I guess but the worst players just cheat with that ultra instinct bull anyway now.Also ideally don't know if this is even doable. But in pvp during a connection one could play at 60 fps and the other could play at 240 but the 240 one would see the 60 fps dude go 240 fps on his screen and the 60 fps dude would see the 240 go 60 fps on his end etc.... This is the ideal scenario I believe especially since not everyone has monitors that can do the faster rates too. | 2020-11-04 03:11:23 |
| Shego | And it wasn't considered wrong before the 1930s for the most part as well. Unless of course it was before puberty which I also think is wrong | 2020-11-03 16:08:38 |
| Shego | I am attracted to non minors even more though. And the personality matters too | 2020-11-03 16:07:09 |
| Tommy Black | but you need to understand how wrong it is. | 2020-11-03 15:08:30 |
| Tommy Black | I really need to know what attracts you to minors. This is not okay shego. You seem like a pretty intelligent man, but saying you want to date minors is absolutely gross. | 2020-11-03 15:08:17 |
| Shego | And my favorite fan art of Kim Possible she is actually drawn to be in her 20s too but in that fan art she also has sick abs and I have a thing for fitness babes too | 2020-11-03 11:44:32 |
| Shego | And right now I don't mess with anyone really | 2020-11-03 09:40:31 |
| Shego | In this culture 14 if I had the consent of the parents which is very unlikely so probably not. In my area 17. I do not have the means to go to another culture where younger is allowed as well. And I would want the consent of the teenager as well and not be into exploitation. | 2020-11-03 09:37:30 |
| Tommy Black | So tell me this Shego, what is the youngest girl you would date/have sexual intercourse with? now this is the real question I wanted to ask you | 2020-11-03 05:22:47 |
| Shego | There was actually a dance instructor in her 50s I thought of asking out but never got the chance cause I became homeless for 6 months and lost contact. I am shy in real life with out my pen and writing tools. | 2020-11-02 19:57:57 |
| Shego | And the voice actress for Kim was a college student at the time older than 18 mixing her personality in with Kim's too | 2020-11-02 19:54:30 |
| Shego | I like the personalities of Kim and Shego more tbh | 2020-11-02 19:51:27 |
| Shego | And I rarely watch cartoons cause I think real life ladies are far prettier too | 2020-11-02 19:50:20 |
| Shego | And true exploitation and just sex are 2 totally different things. Course since the culture is totally different I have to accept and respect this which I actually do now at this point too but I am open to other ways as well. I do not mess with under 17 and yes the age of consent in my area is 17 not 18. Age of consent in Nevada is even less strict but i am not there anymore. And I am still a virgin and mostly just watch pornagraphy at the moment. Only child porn I see is cartoon porn though since many cartoon characters are 14-young 20s | 2020-11-02 19:49:00 |
| Shego | Teenagers are totally different than both young adults and children even up to 19 and even older too. I practice astrology and believe most people don't fully understand who they are and what they are capable of till at least the age of 40 too | 2020-11-02 19:44:31 |
| Shego | And I have heard of underground sex trafficking which I believe exists easier and the corruption in this exists easier too if it is not really known about and statutory rape laws exist too | 2020-11-02 19:42:19 |
| Shego | Also Juries didn't give a ♥♥♥♥ about statutory rape laws and rarely convicted till around world war 2 and they only started caring cause of feminazi and certain church groups advocating for ages like 16-21. Back in the day tobacco was sold to under 21 too I think | 2020-11-02 19:41:06 |
| Shego | well a 9 year old is still clearly a child of course. 18 + is still good for me. In fact when I was 4 I was only attracted to 17+ at the time. I didn't really think of natural puberty till watching Kim Possible and reading about other and older cultures in it too | 2020-11-02 19:37:36 |
| Tommy Black | but puberty isn't just some thing that happens over night Donald. it's a process that can take years to fully develop as to why 18 is the perfect age for being an adult. | 2020-11-02 14:17:40 |
| Shego | That work with nature in when puberty actually happens instead of some age that was chosen | 2020-11-02 14:15:25 |
| Tommy Black | It was an age that was chosen because you're an adult. Being age 16 and younger you don't really know any better. and I don't see the attraction in girls under 18, what do you see that's so attractive? Why isn't girls aged 18 and older good enough for you? | 2020-11-02 14:14:45 |
| Shego | That work with nature in when puberty actually happnes instead of some age that was chosen | 2020-11-02 14:08:19 |
| Shego | I think in cultures that work with nature when a child goes through puberty they are ready to have sex and understand what it is. But in other cultures during and after world war 2 it is not ok to have sex with people under 18 or whatever age is/was chosen in the area | 2020-11-02 14:07:21 |
| Tommy Black | and yes please do post links off your debates on here. I would love to see them | 2020-11-02 14:04:18 |
| Tommy Black | Ok, well since you're here. I wanna ask you a series of questions. first question being. Why is that you think pedophillia is a fine thing? I want an honest and genuine answer Donald. | 2020-11-02 14:03:34 |
| Shego | I'd also rather debate cannabis and marijuana with substance abuse counselors than the history and differences in cultures first as well concerning statutory rape | 2020-11-02 13:55:01 |
| Shego | And the video I shared on the non political persons channel wasnt really about this either you just changed the topic as well cause you hate me on this legendarily so | 2020-11-02 13:52:18 |
| Shego | But tell you what I am prob gonna record these debates once I get to them and I can share the recordings here too . I have the balls to do that | 2020-11-02 13:50:56 |
| Shego | I'd rather debate actual people in person knowledgeble as in have degrees in psychology and or treat people concerning statutory rape laws and the differences of different cultures in this than random people on the net. | 2020-11-02 13:50:14 |
| Tommy Black | Jade and Yasmin had a gangbang last night | 2020-10-12 16:35:40 |
| D R E C K $ | Signed by MrBallen | 2020-10-11 08:16:31 |
| Tommy Black | wtf r u on about? | 2020-10-10 05:17:06 |
| Leex | holes are disgusting ? tell that to your gf oh i forgot you dont have one | 2020-10-09 17:53:41 |
| thicc booty | same with you having 2 huge ass kebaps at once | 2020-10-05 16:34:38 |
| Tommy Black | Same with Wills having 3 x Dominos | 2020-10-05 16:01:31 |
| thicc booty | Still holes are disgusting | 2020-10-05 12:41:51 |
| Tommy Black | Yis u do | 2020-10-04 14:29:27 |
| thicc booty | Eww do I | 2020-10-04 14:23:37 |
| Tommy Black | Rip you have Trypophobia | 2020-10-04 14:10:17 |
| thicc booty | That bee in your showcase is destroying my brain, im scared of these holes :( | 2020-10-04 14:05:55 |
| Ghostie | Dominoes pizza October 9th 2020 | 2020-10-04 13:27:45 |
| Tommy Black | You're always welcome back here to spread as much as you would like! | 2020-09-29 13:40:12 |
| Tommy Black | and little boy is your little defense mechanism. because deep down, we all know you're a little 15 year old boy who talks crap online, but if you were here in real life, you'd be too afraid to say anything. nice try though. | 2020-09-29 13:39:47 |
| Tommy Black | I am using hacks am I? If I was potentially using hacks, why didn't you whip out the record button so u can show the devs? That's the dumbest ♥♥♥♥ I've heard. do you how complementary saying I CHEAT is? it makes it sound like you think I'm a god tier killer. ty | 2020-09-29 13:38:43 |
| BuzzBucko_YT | Yeah little boy look how many people you got mad with using your hacks cheat go back to fortnite little boy | 2020-09-29 13:31:27 |
| Tommy Black | Come cry some more | 2020-09-29 08:00:00 |
| BuzzBucko_YT | -Rep tunneling noob baby killer needs to learn to play they say rank doesn't matter lol goes to show the ♥♥♥♥♥♥♥ you get on this game | 2020-09-29 07:49:19 |
| BuzzBucko_YT | This guys crap hahahahaha all he does his facecamp LOL get good trash killer piece of *** I run for ages what a salty killer | 2020-09-29 07:48:35 |
| Tommy Black | Stop tunneling and then I will. Thanks :)) | 2020-09-27 04:11:10 |
| IJexol™I | Hope you're doing alright, king. | 2020-09-25 10:28:29 |
| Puhes | signed by Puhes | 2020-09-25 06:19:25 |
| Tommy Black | You're a legend mate | 2020-09-20 14:17:42 |
| Tommy Black | Another BOT account spamming the same old ♥♥♥♥ | 2020-09-20 05:32:46 |
| Tommy Black | Pretty sure you don't care whether I have a good weekend or not lmfao | 2020-09-20 05:32:15 |
| Tommy Black | You literally add anyone on my friends list lol. You got an addiction to adding people lmao | 2020-09-01 08:23:34 |
| 💞✨Lara Crofter✨👑 | oh Steph.. I always wanted to add you :3 | 2020-09-01 08:15:59 |
| Tommy Black | You KILL themmmmmm. Those innocent insects :(((. And no swearing here. That's very naughty | 2020-08-31 15:23:52 |
| 💞✨Lara Crofter✨👑 | they ♥♥♥♥♥♥♥ piss me off... | 2020-08-31 15:19:33 |
| 💞✨Lara Crofter✨👑 | The flies fly to me, no one asked them to fly to me, they flew into the forbidden zone, so I killed them as intruders | 2020-08-31 15:18:53 |
| Tommy Black | Cold air?? That ainT good. Don't do this Mia or no more flies ever! | 2020-08-31 15:12:01 |
| 💞✨Lara Crofter✨👑 | Have a wonderful week! My cold air kiss will give you strength in games! | 2020-08-31 15:10:40 |
| Redix34 | -rep face camper | 2020-08-28 02:54:15 |
| mnaf | The legendary Tommy SSJ3!! <3 | 2020-08-27 08:07:35 |
| Tommy Black | Thanks babe | 2020-08-27 05:22:03 |
| STRELAvJOPE | Camper | 2020-08-27 04:24:25 |
| Tommy Black | Nah nah. Yours is definitely better lol | 2020-08-18 06:24:47 |
| Doja | Even better profile - 11/10 c: | 2020-08-18 06:04:06 |
| Steph S. | $$____$$$$____$$$$____$$$$____$$___$$$$___$$$$$___$$$$$__$$____$$$$$$$$$$__$$__$$__$$__$$__$$__$$_$$____$$$$____$$____$$$$__$$__$$__$$__$$__$$__$$$$____$$__$$__$$__$$__$$__$$__$$___$$$$___(¯`:´¯)$$____$$___$$$$$__$$$$$___$$$$$_____$$__(¯ `•.\|/.•´¯)__________________$$______$$________$$_(¯ •.⋐()⋑.•¯)__________________$$______$$_______$$___(_.•´/|\`•._)__________________$$______$$______$$______.(_.:._)$$____$$____$$______________$$______________________$$$$____$$____$$______________$$______________________$$$$____$$____$$______________$$______________________$$_$$__$$$$__$$__$$$$___$$$$__$$__$$_$$$$__$$$$$___$$$$$_$$__$$$$__$$_$$__$$_$$__$$_$$_$$_$$__$$_$$__$$_$$__$$__$$_$__$_$$__$$$$$$_$$$$$$_$$$$__$$$$$$_$$__$$_$$__$$__$$$$__$$$$__$$_____$$_____$$_$$_$$_____$$__$$_$$__$$___$$____$$____$$$$___$$$$__$$__$$_$$$$__$$__$$__$$$$$ | 2020-08-07 13:23:05 |
| Tommy Black | Probably the best thing I've heard all day. Very noice | 2020-08-01 10:18:40 |
| esteban | I genuinely enjoy fishing.I just wanted you to know that | 2020-07-31 14:46:17 |
| Tommy Black | Neverrr | 2020-07-29 08:02:56 |
| 💞✨Lara Crofter✨👑 | Yorkshire Tea - The best tea! | 2020-07-29 08:00:51 |
| Tommy Black | oh yea I remember | 2020-07-29 04:47:25 |
| 💞✨Lara Crofter✨👑 | well my nickname was Lara Croft, we wanted to play RD Online, but you couldn't and added me to your blacklist and then removed me from blacklist. Six months later I came across your page and realized that you are ♥♥♥♥♥♥♥ Tommy! SOOO WHAT'S UP? | 2020-07-29 03:37:42 |
| Tommy Black | I have absolutely no idea who u are | 2020-07-29 02:36:17 |
| 💞✨Lara Crofter✨👑 | yo english warrior how are ya? long time no see haha | 2020-07-28 20:36:07 |
| Jotita | gil | 2020-07-22 14:17:32 |
| Dullahan | Big fan of camping and tunneling in DBD. | 2020-07-13 15:07:41 |
| adsam56 | -rep | 2020-07-13 14:54:40 |
| adsam56 | Camps and tunnels in DBD | 2020-07-13 14:54:34 |
| burned chicken nugget | Camper, tunneler in dead by daylight stop camping ♥♥♥♥ | 2020-07-13 08:18:26 |
| Tommy Black | love u Katie with da D | 2020-07-10 13:38:25 |
| Ghostie | no skilled mug, just no | 2020-07-05 09:07:29 |
| Tommy Black | ty skilled <3 | 2020-07-05 07:20:14 |
| A.I. Engineer | Your steam profile is probably one of the nicest ones I've seen. Got me looking at it like dang, why am I jealous of a steam profile set up haha. | 2020-07-05 06:25:17 |
| Princess Zelda ▲ | Tommy got his cheeks pounded by a DOOD | 2020-07-04 16:38:56 |
| Tommy Black | We do it together since we're baddies | 2020-07-04 16:37:31 |
| esteban | Thank you for rating my artwork https://steamcommunity.com/sharedfiles/filedetails/?id=2139814607 | 2020-07-04 16:18:46 |
| Klang | -rep (cringe center here) , here you have probably a teen in his disturbed s exuality life since he have a cringy cliche of a lewd anime girl cu nt face smiling , surely because this teen will never have a girlfriend and so better wants to fap on drawings or mastu rbate on pillows for his whole life , and also will forever be a vi rgin. so basically i carryed him on csgo cause he su ck at the game (like he suck his anime pillow irl , or maybe he didn't had money to buy one) , apparently i'm trash at csgo because i used a voice changer to trigger his little braindead mind , whilst i was just carrying him because i had enough of him screaming with his edgy voice in the chat. anyway maybe he can't figure out that he's the actual one who suck and can't learn from his mistakes , cause yeah guys beside only baiting , screaming , and annoying the whole ♥♥♥ king game even the ennemies , he deserve the gold medal for 'stereotypical crybaby anime teen virgin' | 2020-07-04 13:06:01 |
| Steph S. | Have a lovely weekend | 2020-07-04 11:00:34 |
| Tommy Black | Where's Gabrielle at? | 2020-07-04 08:47:44 |
| X3Na | +rep Super Saiyan Profile | 2020-07-04 08:38:07 |
| Tommy Black | why what have I done? lol | 2020-07-04 05:30:57 |
| esteban | I appreciate you | 2020-07-03 18:41:17 |
| Skarzon | +rep cool friendly dude and good palyer :)its ssj3 :D | 2020-06-30 11:49:12 |
| Klang | -rep Toomy nobb | 2020-06-27 18:19:40 |
| Tommy Black | There's too many tards on steam. I'm embarrassed that my favourite thing has a swarm of low IQ individuals. | 2020-06-27 10:01:35 |
| thicc booty | SAVAGE OMMY, GO ONNNNN | 2020-06-27 09:47:35 |
| Tommy Black | Stop this stupidness, you simpleton ♥♥♥♥ | 2020-06-27 07:03:14 |
| Tommy Black | I have a profile of drawings? okay LOL | 2020-06-27 07:02:58 |
| Tommy Black | Love how you just deleted your comment. did I hurt your feelings some more? aw www, don't cry | 2020-06-27 07:02:42 |
| Night Swift | you have a profile with drawings, ♥♥♥♥♥♥ in the mouth to cover you like a stupid child | 2020-06-27 07:02:26 |
| Night Swift | stop crying in the dead of autistic hell, after you're stupid and signal | 2020-06-27 07:01:53 |
| Tommy Black | How can you call me autsim when you can't even spell basic English words? get the f uck of my profile with this embarrassment | 2020-06-27 07:00:24 |
| Tommy Black | ''I recording all the game''. Can you at least ♥♥♥♥♥♥♥ speak fluent English before typing absolute garbage on my profile. And there is absolute no way that a low IQ ♥♥♥♥ like yourself will get me banned on Rocket League. So many people have failed. | 2020-06-27 06:49:54 |
| Night Swift | ♥♥♥♥♥♥♥ ♥♥♥♥ playerstupid trooler | 2020-06-27 06:17:13 |
| thicc booty | you're not allowed to call him "daddy" okay? | 2020-06-25 16:03:53 |
| Ghostie | go on daddy keem | 2020-06-25 16:02:29 |
| Tommy Black | Tank you maxi boi | 2020-06-25 13:21:55 |
| IJexol™I | Looking sick, Tommy. | 2020-06-25 13:21:02 |
| 🍕💲Banana🍕💲 | +rep friendly | 2020-06-25 04:31:23 |
| Tommy Black | You angered the Ogre. shrek ain't happy with you Kel | 2020-06-18 08:13:54 |
| Tommy Black | How does asking for a modder for money make me a queer? | 2020-06-15 05:20:27 |
| a new pc and 2k€ later | quit begging for money on gta forums queer | 2020-06-15 05:15:22 |
| LOOPr | lucky | 2020-06-13 07:58:28 |
| Potat | He tends to bm and get mad if you loop him for ages and still loses. | 2020-06-06 03:55:20 |
| Tommy Black | Deji u better | 2020-06-02 15:12:29 |
| ben | ill bust u and gib up | 2020-06-02 15:12:05 |
| Tommy Black | Also Deji my man stop being so Salty. you gotta train for Gib. stop playing DBD | 2020-06-02 15:11:47 |
| Tommy Black | I wasn't leigon lol. I was Ghostface | 2020-06-02 15:11:10 |
| ben | camping trash | 2020-06-02 15:08:09 |
| Iuliqe | -rep kill yourself ♥♥♥♥♥♥♥ legion camper ♥♥♥♥ you | 2020-06-02 15:05:30 |
| Tommy Black | The guy who made that copypasta on reddit is one sick individual. Like c'mon | 2020-06-02 03:52:29 |
| IJexol™I | A nonce for using a reddit copypasta on steam, yes. A nonce for using an inappropriate copypasta about Isabelle, also yes. | 2020-06-02 02:14:11 |
| Tommy Black | Ofc it was lol. unless he's literally telling us all that he's a full on nonce | 2020-06-01 14:59:33 |
| IJexol™I | Oh so this really was a copypasta. I knew it. | 2020-06-01 12:27:34 |
| Tommy Black | maaate wtf | 2020-06-01 12:25:47 |
| gambit femboy | https://www.reddit.com/r/copypasta/comments/gu741a/animal_crossing_nsfw/ | 2020-06-01 12:11:20 |
| Tommy Black | you mad? | 2020-06-01 07:49:39 |
| Vhaziri | nope. still scum. you aren't forced to play like scum, you choose to play like one. | 2020-06-01 07:44:47 |
| Tommy Black | 'Furitve Chase' every time someone unhooks the obsession from the hook, they become the obession. and I had the daily where I needed to put 15 obessions on the hook. I'm hoping you understand a bit better now | 2020-06-01 07:28:54 |
| Vhaziri | right, that camp a hook challenge. got it | 2020-06-01 07:25:22 |
| Tommy Black | I had a daily on one of my tomes which basically forced me to sit around the hook. | 2020-06-01 07:11:59 |
| Vhaziri | ghostface that sits next to the hook in stealth, every time. | 2020-06-01 07:08:42 |
| Tommy Black | idk Snowmaen. but I gotta say, this whole comment definitely tells me that POP squad or predator poachers should be onto your ass. Noncery is not accepted! | 2020-05-31 17:52:28 |
| gambit femboy | ♥♥♥♥♥♥♥♥♥ guys. I can't believe what just happened.For context, i'm 16M, my little sister is 5F. During quarantine, i've been playing a lot of Animal Crossing with her. We got a pretty cool world, she loves to play the game. So yesterday, she was playing it all alone in the living room, I went to take a peek, when i saw Isabelle on the screen. ♥♥♥♥♥♥♥♥♥. My ♥♥♥♥ got so ♥♥♥♥♥♥♥ big. I could see the veins of my fat ♥♥♥♥ through my pants. I thought no one was home, so I started slapping the sausage to Isabelle on my little sister's screen. After 3 minutes i was about to ♥♥♥. I could feel the thicc nut coming in Isabelle's tight inner dog ♥♥♥♥♥. When i could feel the ♥♥♥ coming, I heard footsteps behind me. Holy ♥♥♥♥. It was the ♥♥♥♥♥♥♥ cleaning lady. I'm so ♥♥♥♥♥♥♥ scared, what do i do? How do i explain i wasn't beating it to my sister but to Isabelle? Reddit, please give me some advice! | 2020-05-31 17:11:38 |
| Bees | -rep, facecamps as Spirit ahahaha | 2020-05-31 06:13:29 |
| Dachi_Furry | -REP DISCONECT | 2020-05-30 11:13:32 |
| Ghostie | its a bit late for the bday comment | 2020-05-28 05:34:04 |
| IJexol™I | Happy bday most dedicated F13 game fan. Fricking legend. | 2020-05-27 23:29:56 |
| Ghostie | happy* | 2020-05-27 17:58:12 |
| Ghostie | jappy bday premium bill, still keep throwing those god pallets down like they are nothing | 2020-05-27 17:38:46 |
| Cool Pita Boy | happy birthday Georgie you beast, i wish you a lot of luck and i will send you some princes corned beef #No50pDonuts | 2020-05-27 12:18:20 |
| IJexol™I | "Oh wow. How the turntables" | 2020-05-27 05:22:45 |
| Tommy Black | XD. Weird how the tides turned | 2020-05-27 05:19:07 |
| Tommy Black | In English? | 2020-05-26 08:28:36 |
| Saytlos | -rep, xyesos na mane | 2020-05-26 07:01:51 |
| Tommy Black | At least someone's honest about it. Imma give u a +rep on your profile for dat one...oh your comments are blocked? Damn imma lose sleep over that.. | 2020-05-26 05:34:35 |
| Tommy Black | I just wanna also admit how horny and hard I get when someone bithes about me on my comments. I get a great tingly feeling | 2020-05-25 17:31:03 |
| Tommy Black | I'm hoping this is your last comment since you look like a bigger moron each time. Please for the love of god, don't comment again. #IReallyDoWantMoreSaltFromYouRats | 2020-05-25 17:29:44 |
| Tommy Black | but to even willingy comment on someones profile, ♥♥♥♥♥♥♥♥ about how they played as killer, I've gotten in your head somehow. It's not like everyday I get a comment from someone talking crap about me. It seems to be only the ones I piss off | 2020-05-25 17:28:33 |
| Tommy Black | I'm actually pretty sure you deleted some of your comments on my profile since I hurt your feelings so much. pathetic man | 2020-05-24 04:59:14 |
| Tommy Black | I'll see you soon. you will be back, as usual. especially when another crybaby comes here, you'll try and tag team which just wont work. It's so easy to shut all you salty ♥♥♥♥♥ down. | 2020-05-24 04:54:42 |
| Tommy Black | Think before you come on my profile. you talk a lot of crap for someone with half a brain. but then again, that would make sense. if you need to get ur stress out, come throw some salt here you utter crybaby. | 2020-05-24 04:53:48 |
| Tommy Black | Says the guy that actually clicks on my profile to actually write a load of crap. who seems more butt hurt? the person that locates a profile and comments about me winning and how he's a salty loser or the person that responds because someone commented on their profile? you are in need of a brain young man, this is worrying. | 2020-05-24 04:52:36 |
| IJexol™I | Eh they probably take inspiration from Ninja's tweets like "The phrase "It's just a game" is such a weak mindset" | 2020-05-21 02:10:10 |
| Tommy Black | That's Dead By Daylight for you | 2020-05-20 17:30:21 |
| IJexol™I | I see people still ♥♥♥♥♥♥♥♥ about strategies they cannot fathom to counter. Fricking manchildren everywhere. | 2020-05-20 13:13:44 |
| Tommy Black | Katie With a D going at it | 2020-05-20 06:18:19 |
| siberzorba997 | i didnt know you have to cleanse all ♥♥♥♥♥♥♥ totems for inner strengthXD also i think inner strenght only works when ur injured not while you scared XD doggo | 2020-05-20 00:56:04 |
| Tommy Black | What the ♥♥♥♥ does simp have to do with me cleansing totems for inner strength. kid-minded people these days using these 'NORM' words without knowing the definition of it. you probably heard your favourite dbd streamer call a killer or a survivor a simp, so now you want to act like him. You people really are the lowest of the low | 2020-05-19 21:04:38 |
| siberzorba997 | -rep ♥♥♥♥♥♥♥ worst survivor just cleansing dull totems and hiding in a locker ah dont forget about the farms without borrowed time :DDD just dodge that lobby this simp will ♥♥♥♥ your game up | 2020-05-19 20:18:45 |
| Tommy Black | Also Princess NUT just owned your ass. | 2020-05-19 06:58:38 |
| Tommy Black | ''Not good at most games, but I have fun.'' then comes onto my profile and talks smack and calls me a crybaby. great one @GHOSTVIRUS | 2020-05-19 06:57:02 |
| Tommy Black | and sensitive. you're the one sensitive. I must have 100% got to your little ego once you start dropping comments on someones profile. like wtf | 2020-05-19 05:08:05 |
| Tommy Black | You came to me first. you comment on my profile, I will respond with as much as anger as I want. but I would never go to someone elses profile to ♥♥♥♥♥ about what happened in a match. it's just so pathetic. I've already won the argument once you comment. now go ♥♥♥♥♥ on someone elses profile. you've probably done it at least 10x today you sad loser. | 2020-05-19 05:07:00 |
| Tommy Black | You clearly care since you took your sweet time to get to my profile to right such a pethetic crybaby reason as to why I should get good. no one does this ♥♥♥♥ unless their butthurt. i would never go on someones comment section and act like a f ucking crybaby. grow up you f ucking manchild. I raped you as killer, I am clearly superior than you at DBD. get over it | 2020-05-19 02:49:28 |
| IJexol™I | Bruh how can they not just deal with it? If they know it's coming to them they should be able to counter it somehow, but nope. They gotta ♥♥♥♥♥ about something to fill up the void in their egos. | 2020-05-18 13:32:55 |
| Tommy Black | Queen Katia going at it | 2020-05-17 09:57:02 |
| Tommy Black | Jade u gotta stop this behaviour | 2020-05-17 02:21:34 |
| Tommy Black | Sorry Jake, but you were just a super easy target :)) | 2020-05-16 15:07:06 |
| Woody_Woodpecker | -rep tunnel + camp killer | 2020-05-16 15:01:28 |
| Tommy Black | cry some more | 2020-05-16 08:15:23 |
| Beans | -rep camping as hag like a little ♥♥♥♥♥ ass ♥♥♥♥♥, kill yourself | 2020-05-16 07:27:38 |
| Tommy Black | You must be somewhat mad/upset if you took the time out of your day to locate my account just to write a terrible mess like this. Salty boy. get the f uck of my profile | 2020-05-12 12:02:05 |
| Daddy never camps | fun survivor, they tried the 4 premades torches+cancer builds but still got 4\4 pretty easily.It was fun tho even if not challenging | 2020-05-12 11:51:32 |
| Tommy Black | Thanks for fueling my comment section you crybaby | 2020-05-10 07:52:23 |
| Tommy Black | Not right now matey | 2020-04-27 13:37:09 |
| ANDRADE.EXE | dude can you help me in the achievement of winning 7 battles in dbx 2? | 2020-04-27 13:00:55 |
| Klang | Dwight is Might | 2020-04-23 13:04:03 |
| Tommy Black | Hi Morning Cruise | 2020-04-20 13:03:11 |
| Ghostie | george | 2020-04-20 12:37:14 |
| Tommy Black | ohh goodddd | 2020-04-20 06:23:24 |
| thicc booty | I did not ommy, your close future fate has been decided by me | 2020-04-20 06:22:47 |
| Tommy Black | oh ♥♥♥♥♥♥♥ Vickyyy. u got it all wrong | 2020-04-20 06:18:36 |
| thicc booty | I'M PROUD | 2020-04-20 06:15:38 |
| thicc booty | "GOOOO ONNNN" TOMMY | 2020-04-20 06:15:32 |
| thicc booty | GOOD WE UNDERSTAN EACH OTHER AND GOOD THAT U WILL SPANK UR ASS ONN | 2020-04-20 06:15:25 |
| thicc booty | YOU CAN'T SAY NO CUZ MI DICTIONARY DOES NOT UNDERSTAND "NO" WORD | 2020-04-20 06:15:02 |
| thicc booty | SO YOU BETTER SPANK UR AS*S ON SOON | 2020-04-20 06:14:15 |
| thicc booty | YOUR AS*S WILL BE MORE PURPLE THAN ZANI'S BOI ASS | 2020-04-20 06:14:04 |
| thicc booty | IF YOU WONT | 2020-04-20 06:13:45 |
| thicc booty | IN ABOUT 55MINUTES | 2020-04-20 06:13:41 |
| thicc booty | I HEARD U ARE GOING TO PLAY DBD | 2020-04-20 06:13:35 |
| thicc booty | WHAT IS UP OMMY | 2020-04-20 06:13:29 |
| Klang | Honestly if I saw this damn thing in my livingroom I'd stomp on it until it was a small brown stain | 2020-04-03 04:16:51 |
| Ghostie | play that xenoverse 1 with your twin, he turned up the volume on his speakers to get your attention. | 2020-04-02 16:41:44 |
| Tommy Black | Yessss vicky. niceee ones | 2020-04-02 16:38:17 |
| thicc booty | +rep bro of my BIG BOOOOOOOO | 2020-04-02 16:38:16 |
| thicc booty | -rep stealing my all unhooks | 2020-04-02 16:37:55 |
| thicc booty | do not worry tommy i got your back | 2020-04-02 16:37:41 |
| thicc booty | of course that you can get some comments | 2020-04-02 16:37:33 |
| Tommy Black | what does 'tyst' mean? | 2020-04-02 05:23:27 |
| lohφ | Tyst | 2020-04-02 05:13:03 |
| IJexol™I | #DicksOutForHarambe | 2020-03-27 00:33:32 |
| Tommy Black | #DicksOutForHarambe | 2020-03-26 15:50:31 |
| Tommy Black | np cute girl | 2020-03-19 06:28:00 |
| _71 | ♥ 🍆 ♥ 💚 ♥ ⚡ ♥ 🍖 ♥ 🏓 ♥ 🐛 ♥ 😺 ♥ 🍇 ♥ 🎽 ♥ 🥒 ♥ 💛 ♥ 🌸My cup hath runneth'd over with love. ♥ ⛳ ♥ 🎈 ♥ 🍧 ♥ 😺 ♥ 🌸 ♥ 🥞 ♥ 🕺 ♥ 🚙 ♥ 📒 ♥ 🎍 ♥ 🍇 ♥ 📕A woman was in love with fourteen soldiers. It was clearly platoonic. ♥ 💗 ♥ 📗 ♥ ⚡ ♥ 🎽 ♥ 💙 ♥ 🐝 ♥ 🌳 ♥ 🐠 ♥ 🏓 ♥ 👑 ♥ 🥗 ♥ 🍆 | 2020-03-18 20:23:08 |
| Steph S. | Stay Safe | 2020-03-17 13:41:46 |
| Tommy Black | same for me luv | 2020-02-28 10:55:38 |
| Tommy Black | Yeah pretty much lol. | 2020-02-25 11:37:46 |
| Tommy Black | Some toxic little boy having a go at me because I was in his team and we lost a game in rocket league lmao. Get these people a lot lmfao | 2020-02-25 11:34:40 |
| Tommy Black | Losing* + you're the one who started to do own goals, why not do the same? | 2020-02-24 16:49:04 |
| Halloween Harry | sad toxic troll kid...loosing... | 2020-02-24 16:44:08 |
| Tommy Black | Disgusting twink | 2020-02-23 14:48:49 |
| Tommy Black | P orn HUB | 2020-02-23 14:47:02 |
| Tommy Black | You go on ♥♥♥♥♥♥♥ and you look up ROBLOX 12 year old boy gets rammed in the buttocks from a big 16 year old daddy | 2020-02-23 14:46:50 |
| IJexol™I | This is the mf tea I wanted in the morning, thanks | 2020-02-22 00:38:11 |
| Tommy Black | You have a hairy a ss u sick ♥♥♥ | 2020-02-21 16:29:58 |
| Tommy Black | Gib Gonna smoke Jakey boi round 5 TKO | 2020-01-30 14:49:43 |
| IJexol™I | Either that or a yandere | 2020-01-30 07:59:51 |
| Tommy Black | You are CONFIRMED gonna be a seriel killer in a few years | 2020-01-27 05:36:19 |
| Tommy Black | Alrightyy | 2020-01-24 09:09:50 |
| IJexol™I | Nah sorry, thinking Jedi Fallen Order instead. Kakarot looks kinda ehh to me | 2020-01-24 06:40:08 |
| Tommy Black | Casual Bratz bi tch | 2020-01-20 18:04:07 |
| Tommy Black | Oh yea I have my boi. Such a great game tho. Already reached the Buu arc lmao | 2020-01-19 07:45:02 |
| IJexol™I | Yoooooo Tommy I see you're going full sweat mode on dbz kakarot, nice. | 2020-01-19 06:59:26 |
| Tommy Black | You too mate | 2020-01-14 18:01:11 |
| Tommy Black | Princess NUT | 2020-01-05 06:04:59 |
| Tommy Black | Vicky wills will be going to the HONG KONG house today to buy himself some chinky food. the exact quote he used was ''Tommy lets get a donnar pizza and some chicken balls and rice''. I think you should go and talk about this to him. it is very disgusting | 2020-01-03 06:30:00 |
| thicc booty | How's your corned beef today? | 2020-01-03 06:21:32 |
| .IX | •*´`*•.¸.•*´`*•.¸.•*´`*•.¸.•*´`*•.¸.•*´`*•.¸.•*´`*• ✦ℳerry ℭhristmas & A ℋappy 2019✦ *•..•*´*•..•*´*•..•*´*•..•*´*•..•*´*•..•*´*•..•* | 2019-12-31 13:30:57 |
| Tommy Black | Yasmin is coming soon don't worry | 2019-12-29 16:26:00 |
| Ghostie | •*´¨`*•.¸¸.•*´¨`*•.¸¸.•*´¨` MERRY CHRISTMAS •*´¨`*•.¸¸.•*´¨`*•.¸¸.•*´¨`_██_*。* . / \ .˛* .˛.*.★* *★ 。*.(´• ̮•)*˛° * /.♫.♫\*˛.* ˛_Π_____. * ˛*( . • . ) ˛° ./• '♫ ' •\.˛*./______/~＼ *. ˛*.。˛* ˛. *。(...'•'.. )*˛╬╬╬╬╬˛°.｜田田 ｜門｜╬╬╬╬ .¯˜"*°•♥•°*"˜¯`´¯˜"*°•♥•°*"˜¯`:albedothumbsup: AND A HAPPY NEW YEAR FOR 2020 :albedothumbsup::zgsanta::zgsanta::zgsanta::zgsanta::zgsanta::zgsanta::zgsanta::zgsanta: :ho::ho::ho: :zgsanta::zgsanta::zgsanta::zgsanta::zgsanta::zgsanta::zgsanta::zgsanta: | 2019-12-25 07:57:59 |
| BugZy | •*´¨`*•.¸¸.•*´¨`*•.¸¸.•*´¨` MERRY CHRISTMAS m8 •*´¨`*•.¸¸.•*´¨`*•.¸¸.•*´¨`_██_*。* . / \ .˛* .˛.*.★* *★ 。*.(´• ̮•)*˛° * /.♫.♫\*˛.* ˛_Π_____. * ˛*( . • . ) ˛° ./• '♫ ' •\.˛*./______/~＼ *. ˛*.。˛* ˛. *。(...'•'.. )*˛╬╬╬╬╬˛°.｜田田 ｜門｜╬╬╬╬ .¯˜"*°•♥•°*"˜¯`´¯˜"*°•♥•°*"˜¯` AND A HAPPY NEW YEAR FOR 2020 from | 2019-12-24 18:24:57 |
| Tommy Black | Thank you lara . Merry christmas to you too | 2019-12-24 15:51:04 |
| thicc booty | Morning is a OOze | 2019-12-23 11:45:30 |
| Feng Minified | + rep mvp in Serious Sam | 2019-12-23 04:17:10 |
| Tommy Black | yessssssss gabe go onnnnnnn | 2019-12-22 09:14:36 |
| Tommy Black | get the ♥♥♥♥ outta of here you pathetic little child. | 2019-12-22 07:56:03 |
| KSV_SaiyanBlade | Dont interfere , because I can expose you too | 2019-12-22 07:54:14 |
| Tommy Black | s hit | 2019-12-22 07:36:24 |
| Tommy Black | and don't come on my profile to talk ♥♥♥♥ about someone when you don't even know them | 2019-12-22 07:36:16 |
| Tommy Black | Rado he literally already said he collected dolls ''I collect dolls because I like them''. so wtf are u on about lmao | 2019-12-22 07:35:19 |
| KSV_SaiyanBlade | I can expose you anytime | 2019-12-22 07:32:21 |
| KSV_SaiyanBlade | You do collect dolls don't act dumb , Not to mention you have Goku x Vegeta wallpapers stored in your pc , which makes you gay and weeb | 2019-12-22 07:31:29 |
| KSV_SaiyanBlade | Gabe, You are surely above 16 years old and you still play with barbie dolls and btw How am I weeb? | 2019-12-22 04:40:38 |
| KSV_SaiyanBlade | +Rep | 2019-12-21 20:28:39 |
| KSV_SaiyanBlade | I am only gonna give this profile +Rep because It gives me the opportunity to meme Zelda aka Gabe. | 2019-12-21 20:28:22 |
| KSV_SaiyanBlade | Imagine being Barbie Dolls Fan like Princess Zelda. LOL | 2019-12-21 20:10:51 |
| Tommy Black | Happy Birthday | 2019-12-13 04:59:12 |
| JBV | it's my birthday today | 2019-12-13 02:44:53 |
| Tommy Black | I'mma get AMBER to put on a STRAPON to pound your tr anny looking hole | 2019-12-09 16:47:13 |
| Tommy Black | I'll beat you up darling | 2019-12-09 14:24:55 |
| Klang | YOU DIDN'T BUY UNDERTALE | 2019-12-06 17:08:34 |
| Tommy Black | Jade you're mega cute #HeelsOn | 2019-12-06 15:34:07 |
| Jade Bratz | Hi tommy its jade from bratz magazine Why is it so hard to see?If I cut myself, I would bleed (kill me)I'm just like you, you're like meImperfect and human, are we? | 2019-12-06 15:30:12 |
| Tommy Black | sasha from bratz | 2019-11-29 14:50:37 |
| Tommy Black | #Bratz4Life | 2019-11-29 14:44:03 |
| Tommy Black | You live in a trampy a s s trailor so go suck on my ♥♥♥♥ ya dirty zelda rat | 2019-11-29 14:43:39 |
| Tommy Black | You got your a s s ripped up by a bratz fan named Misty who ate your dumps up | 2019-11-29 14:42:37 |
| Tommy Black | at least I don't wank over cupcakes nips ya fat stinky bratz ♥♥♥♥♥♥ | 2019-11-29 14:41:59 |
| Tommy Black | P I S S * | 2019-11-29 14:40:58 |
| Tommy Black | At least I don't have a room in my house full of cat dump and piss | 2019-11-29 14:40:39 |
| Tommy Black | Go suck on your mumma;s big toots. they smelling good after Angela tooted on them | 2019-11-29 14:38:41 |
| Tommy Black | You're a fat bratz fan with onion armpits | 2019-11-29 14:36:41 |
| Tommy Black | Go play with your BRATZ dolls | 2019-11-29 06:43:51 |
| Tommy Black | Zan's fat ass chops | 2019-11-29 06:42:25 |
| Tommy Black | Zan will die | 2019-11-29 06:42:06 |
| Ghostie | Buy undertale or zan will slap you | 2019-11-29 05:56:18 |
| Tommy Black | #FirewatchGameOfTheYear2019 | 2019-11-25 11:50:32 |
| thicc booty | Lies | 2019-11-22 17:31:15 |
| Tommy Black | Never ever!! | 2019-11-22 17:21:03 |
| thicc booty | Everyone knows that you you love him | 2019-11-22 17:16:38 |
| Tommy Black | This is false stuff | 2019-11-22 17:16:18 |
| thicc booty | How was your date with Logan Paul? | 2019-11-22 17:12:43 |
| Tommy Black | Zan's 20th neck just got excited | 2019-11-22 16:57:40 |
| thicc booty | apparently morning said hi but only to get validation | 2019-11-22 16:56:49 |
| Tommy Black | No Yasmin. comment that on Twink's profile | 2019-11-21 11:02:46 |
| IJexol™I | The Frieza name situation is the same as Vegito's. I'm just being politically correct lul but it's more personal preference than anything. Some people call Vegito Vegerot btw. | 2019-11-17 06:11:27 |
| Tommy Black | huh? | 2019-11-17 04:17:18 |
| IJexol™I | Freeza* | 2019-11-17 00:03:20 |
| Tommy Black | Someones bumming that new KSI song a bit too much | 2019-11-15 06:41:57 |
| Ghostie | ᴡʜʏ ʏᴏᴜ ɢᴏᴛᴛᴀ ɢᴏ, ɢᴏ ᴀɴᴅ ʟᴇᴛ ᴍᴇ ᴅᴏᴡɴ ʟɪᴋᴇ ᴛʜᴀᴛ (ᴀʏʏ)ᴅᴏᴡɴ ʟɪᴋᴇ ᴛʜᴀᴛᴏʜ ᴡʜʏ? ᴡʜʏ ʏᴏᴜ ɢᴏ ᴀɴᴅ ʟᴇᴛ ᴍᴇ ᴅᴏᴡɴ ʟɪᴋᴇ ᴛʜᴀᴛ? (ᴀʏʏ)ᴅᴏᴡɴ ʟɪᴋᴇɪ ᴡᴀꜱ ɴᴏᴛʜɪɴ' ʙᴜᴛ ʟᴏʏᴀʟ ᴛᴏ ʏᴏᴜ ʀɪɢʜᴛ ꜰʀᴏᴍ ᴛʜᴇ ꜱᴛᴀʀᴛʏᴏᴜ ᴄʜᴀɴɢᴇᴅ ᴜᴘ ᴏɴ ᴍᴇ ᴀꜱ ꜱᴏᴏɴ ᴀꜱ ᴛʜɪɴɢꜱ ᴡᴇʀᴇ ɢᴇᴛᴛɪɴɢ ʜᴀʀᴅɪ’ᴠᴇ ᴀʟᴡᴀʏꜱ ꜱᴇᴇɴ ᴛʜᴇ ʟɪɢʜᴛ ᴅᴇꜱᴘɪᴛᴇ ᴜꜱ ʙᴇɪɴɢ ɪɴ ᴛʜᴇ ᴅᴀʀᴋᴀɴᴅ ʏᴏᴜ ʟᴇᴛ ᴍᴇ ᴅᴏᴡɴ ʟɪᴋᴇ ᴛʜᴀᴛ, ʏᴇᴀʜ, ᴅᴏᴡɴ ʟɪᴋᴇ ᴛʜᴀᴛ (ᴏʜ ᴡʜʏ) | 2019-11-15 06:18:55 |
| Ghostie | ʏᴇᴀʜ, ʏᴇᴀʜ, ɪ ᴡᴀɴᴛ ᴛʜᴀᴛ ᴋɴᴏᴄᴋᴅᴏᴡɴꜰᴜᴄᴋ ᴜᴘ ᴛʜᴇ ꜱʏꜱᴛᴇᴍ, ᴍᴀᴋᴇ ɪᴛ ꜱʜᴜᴛ ᴅᴏᴡɴɪ’ᴍ ᴄᴏʟᴅ ᴡɪᴛʜ ᴛʜɪꜱ, ꜱʟᴏᴡ ᴍᴀɴ ᴅᴏᴡɴ ʟɪᴋᴇ ꜰʀᴇᴇᴢᴇʀ (ᴍᴍ)ᴡᴀɴɴᴀ ʙᴀᴄᴋꜱᴛᴀʙ ʟɪᴋᴇ ꜰʀɪᴇᴢᴀ (ᴍᴍ)ᴅɪᴄᴛᴀᴛᴇ ᴅᴇᴀᴛʜ ʟɪᴋᴇ ᴄᴀᴇꜱᴀʀ (ᴍᴍ)ᴀʟᴡᴀʏꜱ ᴄᴏᴍᴇ ᴛʜʀᴏᴜɢʜ ᴡɪᴛʜ ᴀ ʙᴇᴇ (ʏᴇᴀʜ)ɢᴏᴛ ᴛᴏ ᴅᴏ ᴀ ʟᴏᴛ ᴛᴏ ᴛʀᴏᴜʙʟᴇ ᴍᴇ (ʏᴇᴀʜ)ᴠɪꜱɪᴏɴᴀʀʏ ꜱᴛɪʟʟ ᴡᴏɴ’ᴛ ᴛᴜɴɴᴇʟ ᴍᴇ (ʏᴇᴀʜ) | 2019-11-15 06:18:46 |
| Ghostie | ᴍᴇ ᴛᴏ ʏᴏᴜ, ɴᴏᴡ ᴛʜᴀᴛ ᴡɪʟʟ ᴄʜᴜᴄᴋʟᴇ ᴍᴇᴅᴇᴠɪʟɪꜱʜ ᴠɪᴇᴡꜱ ᴡʜᴇɴ ᴛʜᴇʏ’ʀᴇ ᴀɪᴍɪɴɢ ᴀᴛ ᴛʜᴇ ᴘʀᴏᴘʜᴇᴛᴇᴍɪᴛᴛɪɴɢ ᴘᴀɪɴ 'ᴛɪʟ ʏᴏᴜ’ʀᴇ ɴᴏᴛʜɪɴɢʀᴇᴍᴇᴍʙᴇʀ ᴡʜᴀᴛ ɪ ꜱᴀɪᴅ ᴡʜᴇɴ ᴛʜᴀᴛ ᴘᴜꜱꜱʏ ᴛʀɪᴇᴅ ᴍᴏᴠɪɴɢ ᴡɪᴛʜ ᴛʜᴇ ᴏᴘᴘꜱ? (ᴡᴏᴏ)ɴᴏᴡ ʜᴇ ʙᴀᴄᴋ ᴡɪᴛʜ ᴛʜᴇ ʙʟᴏᴄᴋꜱ, ɴɪɢɢᴀ | 2019-11-15 06:18:33 |
| Tommy Black | Bratz boi | 2019-11-12 11:19:29 |
| Tommy Black | WE NEED TO SEE A TRILOGY TO ALL THIS IN 2020 NOVEMBER!!!! #TEAMKSI LETSSS GO CHAMP | 2019-11-10 17:10:10 |
| Tommy Black | #TEAMKSI | 2019-11-10 07:34:35 |
| Tommy Black | What a ♥♥♥♥♥♥♥ night that was. one of the best nights of my life. the anticipiation leading up to that VERY moment. so intense, what a great fight between the pair. my boy JJ secured the W and comes home a undefeated man1 letsssss gooooo!! #TEAMKSI | 2019-11-10 07:34:27 |
| Tommy Black | My boy actually ♥♥♥♥♥♥♥ did it!!! 6th round . letssss goooooooooo JJ #TEAMKSI | 2019-11-10 07:33:23 |
| Tommy Black | FIGHT NIGHT! 7 hours 30 mins until the main event STARTS! | 2019-11-09 14:34:54 |
| Klang | Ok Morning | 2019-11-06 13:43:22 |
| Tommy Black | 4 days left until FIGHT NIGHT | 2019-11-05 04:09:44 |
| Tommy Black | 6 seconds until rip Jades head off | 2019-11-03 09:51:35 |
| Tommy Black | 6 days until FIGHT NIGHT | 2019-11-03 05:06:08 |
| Tommy Black | Halloween here ain't for another 10 hours | 2019-10-30 09:51:41 |
| Tommy Black | No problem | 2019-10-30 03:21:30 |
| AveryFB | Ahh, ok thx, was just curious, thanks for joining! | 2019-10-30 02:54:50 |
| Tommy Black | I was Subscribed to the comments on the ORIGINAL rdr group, so when you commented on it, It instantly came through to my inbox on steam. | 2019-10-30 02:32:06 |
| AveryFB | How did you find my RDR2 group btw? I legit JUST made it. | 2019-10-30 02:02:18 |
| Tommy Black | yea sure ting | 2019-10-22 12:45:29 |
| マイラ DEATHBRINGER | Have a beautiful Day XD Make sure to post in the Melanie Martinez Group every now and then since I'm trying to revive the community https://steamcommunity.com/groups/CRYBABY_K-12 | 2019-10-22 09:07:33 |
| Tommy Black | KSI V LOGAN 2 - https://steamcommunity.com/groups/ksiVlogan2 #TEAMKSI | 2019-10-11 16:05:14 |
| IJexol™I | And I wonder why I don't want to play DBD | 2019-10-03 23:33:40 |
| Tommy Black | yessssss leeex my boi <3 | 2019-10-03 16:12:06 |
| Leex | Hey Nurse go ♥♥♥♥ yourself ♥♥♥♥♥! | 2019-10-03 16:11:42 |
| Tommy Black | Gotta have Michael for a bit | 2019-10-03 13:52:25 |
| Ghostie | bring back babatunde. aka babaneck | 2019-10-03 13:39:31 |
| Tommy Black | I have absolutey no problem with the nurse you stupid ♥♥♥♥♥♥♥ moron. | 2019-10-02 09:32:55 |
| Eq | -rep геtагdеd diскhead, do you feel the difference between a nurse and a baby piggy? | 2019-10-02 09:13:07 |
| Tommy Black | You tell them girl | 2019-10-02 09:00:45 |
| Tommy Black | Don't ever comment again about leaving against killers. Just have a look at your name. wtf you hypocritial ♥♥♥♥ lol | 2019-10-02 08:58:54 |
| Eq | -rep Leaver vs baby Piggy | 2019-10-02 08:52:27 |
| Tommy Black | love you Jade | 2019-09-28 01:37:24 |
| Tommy Black | Wtf ahhhhaaaaahhhhaa | 2019-09-27 13:49:47 |
| Sexy Ace | https://youtu.be/5ojedxpk2G8 | 2019-09-27 13:44:53 |
| Sexy Ace | https://www.youtube.com/watch?v=FveF-we6lcE | 2019-09-27 13:44:40 |
| Sexy Ace | (fart noise)UH OHStinkyPoopHahahahPoopies funny poopies lalalala hahaFunny poop poop funny wooooooooHaaha yay for poopy good poopy poopy funny hahahaPopopopopopo funny yay fun fun poop hehehe poop poppiesPoop make me happy happy happy yay hahahUH oh i think i made a poopiePooping pants no diaper thats funny hahahaOopsiePoopie underwear now hahahWe want poopiesWe want poopies hahahaHahahahaa(wheezing)Poo-oo-oppoop | 2019-09-27 13:44:31 |
| Tommy Black | Hello kesh. What's dis new name and pic | 2019-09-27 13:21:08 |
| Sexy Ace | uh oh stinky | 2019-09-27 12:59:27 |
| Tommy Black | Yeah, well I wanted to quit to play with someone. Am I not allowed to do that? You seem awfully controlling for someone I haven't met before. Damn, what's it like if I was your friend...Jheez | 2019-09-24 11:41:05 |
| ★ꃅꍟ꒒ᖘꍟꋪ★ | So, 2 guys dc'ed at the same time, when i got one of you, and letting the other 2 guys alone, with 5 gens? Damm, what a teammate! Im proud of you | 2019-09-24 11:38:12 |
| Tommy Black | my Friend wanted to play so I quit. I don't see how that makes me toxic you ♥♥♥♥♥♥♥ idiot. please explain yourself | 2019-09-24 11:32:00 |
| ★ꃅꍟ꒒ᖘꍟꋪ★ | -rep Toxic Surv lol | 2019-09-24 06:51:28 |
| Tommy Black | No problem lasagne neck | 2019-09-02 11:09:42 |
| Cool Pita Boy | thank you ommy | 2019-09-02 04:43:27 |
| Azakira | Have a nice weekend | 2019-08-17 17:56:40 |
| IJexol™I | +Rep No u | 2019-08-10 00:59:59 |
| Tommy Black | my man! | 2019-08-09 12:32:21 |
| Nick Wilde the Doppelgänger™ | +rep Best boiii to talk to. A true friend indeed. And an archive full of rad screnshots :] What more do you need in life to be happy? PLUS anyone who loves Claire Redfield just as much as I do, is a friend for life! | 2019-08-09 12:24:03 |
| Tommy Black | Thanks. love helping my fellow teammates out <3 | 2019-08-09 08:26:04 |
| Slippy | -rep killed me by unhooking 2 times in front of the killer without bt, nice job | 2019-08-09 08:23:36 |
| Tommy Black | nice to meet you too. You have a beautiful weekend as well . | 2019-07-27 14:27:06 |
| Stoorks | Hi, nice to meet you! Have a beautiful weekend! | 2019-07-27 14:06:43 |
| Tommy Black | Idiot? You were the stupid ♥♥♥♥ tard that got us in that situation. You and Bill were immensely dumb, I literally thought I was playing with the summer sale people or Free to play people. | 2019-07-27 05:25:52 |
| 孤独 | idiot! | 2019-07-27 05:20:09 |
| Klang | Look out, it's a transgender! | 2019-07-26 16:39:35 |
| Ghostie | its mornay | 2019-07-23 05:29:42 |
| Tommy Black | Looks ♥♥♥♥ mate | 2019-07-15 05:42:37 |
| Leex | Wow go watch Liar Liar right ♥♥♥♥♥♥♥ now | 2019-07-14 18:01:06 |
| Tommy Black | Who is Fletcher Reede? | 2019-07-14 16:19:16 |
| Leex | What's up Fletcher Reede ? | 2019-07-14 13:55:42 |
| Tommy Black | sup | 2019-07-14 07:10:32 |
| KSV_SaiyanBlade | above has disease | 2019-07-08 17:15:30 |
| KSV_SaiyanBlade | +rep Tommy and Jexol Infected | 2019-07-08 17:15:20 |
| Tommy Black | damn guys | 2019-07-08 08:43:31 |
| KSV_SaiyanBlade | above has disease | 2019-07-08 06:38:01 |
| KSV_SaiyanBlade | EarthWorm is carrying them not curing infected | 2019-07-08 06:37:47 |
| IJexol™I | I use your earthworm s whatever to cure my disease so suck on that please | 2019-07-08 06:35:12 |
| KSV_SaiyanBlade | +rep 1 infected- Jexol | 2019-07-08 06:33:16 |
| IJexol™I | +rep best buddy, fun friend to play with and no i do not have cancer | 2019-07-08 06:32:04 |
| KSV_SaiyanBlade | +Rep Above has disease | 2019-07-08 06:30:28 |
| Diaboli | +rep good guy and god player:D | 2019-07-04 11:52:38 |
| Chomiczka | -rep camper naucz sie grac rozjebancu | 2019-07-03 07:41:11 |
| Ghostie | Morning you need to add tigerJhung back to get some free games | 2019-07-01 21:38:17 |
| Strangelittleknopf | This Noob are a Camper in Dead by Daylight | 2019-07-01 03:29:58 |
| Klang | The muslims are already here | 2019-06-30 10:22:11 |
| Ghostie | klang go home before the muslims come | 2019-06-30 10:21:51 |
| Klang | Technically you're a bit gay and a bit weeby. That makes you a gay weeb. Also toy story is the best anime ever | 2019-06-30 10:20:36 |
| Ghostie | the definition you wrote still does not match him tho. He has pics and screenshot of dragon ball all over his profile, that both does not mean he is 1. obsessed with japanese culture and 2. behaves in a stereotypical Japanese manner. don't post a definition to describe what someone is if the description of the definition does not match the person correctly. You seem to think by having dragon ball pics he therefore must be obsessed with japanese culture and must act in a stereotypical japanese manner irl. | 2019-06-30 10:19:55 |
| IJexol™I | Technically you're just a fan of dragon ball and yu yu hakusho, but you can only be called a weeb if you try to use weeb language called JAPANESE yourself, making yourself look like a ♥♥♥♥♥♥ in the process. | 2019-06-30 08:34:45 |
| Tommy Black | You're the one who was a aggressive calling me a weeb first so shut your mouth you dumb ♥♥♥♥. and I hope you take good care of your SWITCH and lay with some Walalugi | 2019-06-30 05:39:11 |
| Tommy Black | yea all u can can call me is a weeb. nice one Chef. You have weeb friends on your steam. I thought u hated weebs? | 2019-06-30 05:21:51 |
| Tommy Black | I am not obsessed with the Japanese culture. so calling me a weeb is irrelevant. I like DRAGON BALL and Yu Yu hakusho. but in no way am I obsessed with any of it. and if there were mario games on steam, I'm sure you would have some walugi screnshots | 2019-06-30 05:17:45 |
| Tommy Black | Had to come to my comment section to try and insult me. you like Walugi which is actually a WEEB character. the character was originated from Japan, and people only call people weebs if they like things which are from Japan. so you're a ♥♥♥♥♥♥♥ ♥♥♥♥♥♥ for saying I'm a weeb, if you literally like characters from Japan. You a hypocritical ♥♥♥♥. | 2019-06-30 05:05:54 |
| Ghostie | ha ha morning ha ha | 2019-06-29 16:06:11 |
| »´ﮛćɧέŋĵą.✘ | ʰᵃᵛᵉ ᵃ ᶰᶤᶜᵉ ʷᵉᵉᵏᵉᶰᵈ | 2019-06-29 07:53:53 |
| Eskahox | -rep leaver | 2019-06-29 06:12:41 |
| Tommy Black | thx vargass. love you my Slovenian man! | 2019-06-28 08:37:24 |
| Feng Minified | + rep best survivor and great teammate | 2019-06-28 03:50:36 |
| Myinsideoutdic | during that match u sat in front of me when it was my first hook, pointed at me so i said ♥♥♥♥ it and tried to get myself off the hook. You then finally pulled me off and the killer was right there. It's fine though you have to keep up your persona on a steam profile. | 2019-06-27 09:38:28 |
| Tommy Black | Selfish? I saved you like 3 times. I even took hits for you. You're just ♥♥♥♥♥♥♥ salty because you didn't escape. It's kinda embarrassing that I saved you so many times but you still couldn't escape. | 2019-06-27 06:49:38 |
| Myinsideoutdic | -rep Selfish Survivor | 2019-06-26 16:36:12 |
| nobody_move w8 | Summer Sale - just buy what are u want <3 Good luck and Have fun!! | 2019-06-26 10:19:09 |
| Tommy Black | thx m8 | 2019-06-25 04:00:14 |
| nobody_move w8 | Happy Week, with love by nobody_move #nbm | 2019-06-24 10:10:21 |
| KSV_SaiyanBlade | +Rep | 2019-06-23 17:06:54 |
| nobody_move w8 | he-he :3 | 2019-06-23 05:38:44 |
| Sky_Misti | +rep fun to play dbd with :) | 2019-06-21 11:51:18 |
| Tommy Black | Sorry max | 2019-06-21 07:58:03 |
| IJexol™I | Now that's just effing hurtful, Tommy. | 2019-06-20 23:50:10 |
| Tommy Black | Unsub then. idgaf. Why are u even subbed in the first place lmao. u ♥♥♥♥♥♥♥ nutter | 2019-06-20 14:21:09 |
| IJexol™I | Honestly this comment section was inflated with a bunch of +reps and love hearts a little cleanup could work ot i'll unsub from the comment section entirely. | 2019-06-20 12:36:32 |
| Tommy Black | Alright mate. You can chill out on the comments now. I've had 5 from you in the last 2 weeks. getting kinda outta hand. | 2019-06-20 07:53:11 |
| Whey | ʜᴀᴠᴇ ᴀ ɴɪᴄᴇ ᴡᴇᴇᴋ | 2019-06-17 21:34:12 |
| Pamsky | | 💛I'm a crazy guy who comments every day. can you interpret me✅ | 2019-06-17 16:05:21 |
| Whey | Have a nice weekend! | 2019-06-13 21:42:48 |
| sbytexx | In the beginningThe angel lucifer was cast out of heaven and condemned to rule hell for all eternityUntil he decided to take a vacationFeel free to add me and cooment something cute on my profile. https://steamcommunity.com/id/lucifer_morningstarr | 2019-06-11 06:42:46 |
| SkooLL | hαvє α grєαt dαч! | 2019-06-10 16:05:45 |
| Tommy Black | ............../´¯/)......................................(\¯`\ ............./...//.........................................\\...\ .........../....//............................................\\ ..\ ....../´¯/..../´¯\........................................./¯`\....\¯`\ ..././.. /..../..../. |_...EPIC STORE....|..\....\....\...\.\ (.(....(....(..../.) .)...............................(.\....).....)...).) ..\................\/.../..............................\...\/................./ ....\.................../................................\..................../ .....\.................(.................................)................../ | 2019-06-10 13:13:58 |
| »´ﮛćɧέŋĵą.✘ | ʷⁱˢʰ ᵘ ᵃⁿ ᵈᵉˡⁱᵍʰᵗᶠᵘˡ ʷᵉᵉᵏᵉⁿᵈ | 2019-06-08 16:29:11 |
| Tommy Black | Shego will be on holiday tomorrow. Just be careful Rado. Don't go out too much or else you might be his next victim! #ShegoOnHoliday | 2019-06-08 15:33:56 |
| KSV_SaiyanBlade | me | 2019-06-08 15:14:31 |
| Tommy Black | Where the kids at? | 2019-06-07 16:16:06 |
| Sexy Ace | AAAAAAA WILLS NOOOOOOOOO | 2019-06-07 11:32:44 |
| Ghostie | Whey come on is this life for you? | 2019-06-07 11:27:35 |
| Whey | Have a nice weekend | 2019-06-06 22:37:42 |
| Tommy Black | They're all good buddy | 2019-06-04 03:35:07 |
| sbytexx | let me know if you are uncomfortable with my comments | 2019-06-03 18:48:31 |
| Tommy Black | But I don't need to freestyle you. You're trying to get an easy win due to your loss in a comp solo. I know for a fact you'll win against me in a freestyle match, I don't play rocket league for free style, I play just normally. what is it gonna prove if I play a free style match with you? please tell me | 2019-06-02 13:24:37 |
| Deadly2DieTV(GER) | but i know ure a chicken and got no honor | 2019-06-02 13:22:26 |
| Deadly2DieTV(GER) | 1 v 1 me freestyle duell thats all !! | 2019-06-02 13:21:53 |
| Tommy Black | Scammer? I beat you, how the hell does that make me a scammer? | 2019-06-02 13:18:58 |
| Tommy Black | ♥♥♥♥ off. Being good at freestyling doesn't mean ♥♥♥♥. I beat you 7-6. so shut the ♥♥♥♥ up and get off my profile you whining bastard | 2019-06-02 13:18:31 |
| Deadly2DieTV(GER) | -rep scammer and bad player | 2019-06-02 13:18:21 |
| Deadly2DieTV(GER) | 1 v 1 freestyle duell now chicken | 2019-06-02 13:17:05 |
| Tommy Black | She only has good hair | 2019-06-01 08:11:15 |
| IJexol™I | Marcarita is better | 2019-06-01 08:02:38 |
| Tommy Black | I bet you're gonna tell me Vados is better. if u do ♥♥♥ off | 2019-06-01 07:48:47 |
| Tommy Black | If I could wife up an anime character/video game character it would have to be Zelda. aka breast enhanced mod. She has to be one of the sexiest girl characters in the video game world/anime world. | 2019-06-01 07:44:18 |
| IJexol™I | +Rep has a good taste in waifus and is a good friend | 2019-06-01 07:16:40 |
| Mr. Overkill 🌟 | A friend who is full of kindness!💕 | 2019-05-31 18:16:06 |
| Whey | ʜᴀᴠᴇ ᴀ ɴɪᴄᴇ ᴡᴇᴇᴋᴇɴᴅ! | 2019-05-30 21:28:28 |
| Tommy Black | I have no idea what you're talking about | 2019-05-30 20:51:44 |
| Tibiia | I wrote wrong is buying with me | 2019-05-30 20:06:37 |
| Tommy Black | Did I buy a trading card from you my kind sir? | 2019-05-30 19:42:21 |
| Tibiia | Thank you for shopping whit me | 2019-05-30 19:25:52 |
| JBV | hi. how are you? | 2019-05-30 08:02:02 |
| Tommy Black | TRIBUTE to Harambe - https://www.youtube.com/watch?v=3rc5yKbGHOY | 2019-05-28 21:24:39 |
| Tommy Black | Happy late Birthday to my favourite ape, Harambe. He was born on the exact same day as me but a year before! #NeverForgetHarambe - 28/5/2016 | 2019-05-28 20:43:38 |
| sbytexx | Have a nice day my friend | 2019-05-28 11:01:12 |
| Whey | ʜᴀᴠᴇ ᴀ ɴɪᴄᴇ ᴡᴇᴇᴋ! | 2019-05-27 21:27:28 |
| Leex | Happy birthday fag | 2019-05-27 16:45:53 |
| Tommy Black | thx morgrian | 2019-05-27 12:08:35 |
| Ghostie | Happy birthday george fripp | 2019-05-27 11:29:27 |
| Tommy Black | @Deadly2Die and if u wanna do a free style match. lets do that. I'm definitely down for that. even though I don't know how to free style, so you're gonna win. but it's irrelevant to what u said though lmao | 2019-05-27 09:30:26 |
| Tommy Black | Thx zan. love you | 2019-05-27 09:25:29 |
| Cool Pita Boy | happy b day george | 2019-05-27 08:55:29 |
| Deadly2DieTV(GER) | funny bu tfresh xD its 1 v 1 we can do a real 1 v 1 with only freestyling if u want xD | 2019-05-27 08:42:46 |
| Tommy Black | 1 v 1 isn't impotant? what kinda of drug you taking? It's ♥♥♥♥♥♥♥ competitive you moron, so if you don't like people TRYHARDING then don't play COMP, you ♥♥♥♥♥♥♥ idiot. | 2019-05-27 08:24:15 |
| Deadly2DieTV(GER) | ure only a bad player because 1 vs 1 is not so important ! and u still try to win and i let u 1 goal scoring than i played like agold 1 player and u cant beat such ppls xYD | 2019-05-27 07:32:13 |
| Tommy Black | Thank you | 2019-05-26 21:48:34 |
| Tommy Black | Happy 19th Birthday to myself I guess | 2019-05-26 18:01:33 |
| Tommy Black | https://www.google.com/search?rlz=1C1CHBD_en-GBGB843GB843&ei=xIvqXMjTC_eU1fAP1PORkAg&q=FRIDAY+THE+13TH+THE+GAME+RELEASE+DATE&oq=FRIDAY+THE+13TH+THE+GAME+RELEASE+DATE&gs_l=psy-ab.3..35i39i70i251j0i22i30l8.2769.4515..4826...2.0..0.221.564.5j0j1......0....1..gws-wiz.......0i71j33i22i29i30.6OJIAst7VmY | 2019-05-26 07:51:28 |
| Tommy Black | LAST DAY OF OFFICIALLY BEING 18! | 2019-05-25 18:00:14 |
| nobody_move w8 | Happy weekend ;3 | 2019-05-25 07:03:55 |
| sbytexx | Have a nice day my friend | 2019-05-24 10:39:30 |
| Whey | Have a nice weekend | 2019-05-23 21:34:13 |
| Keemstar | Bring back DBSuper or I say the n word | 2019-05-20 18:18:05 |
| Tommy Black | I think it's very disturbing tbh | 2019-05-20 10:56:54 |
| Ghostie | thoughts on george winston fripp sh*tting himself for army appointment? | 2019-05-20 10:48:53 |
| Leex | Great friend | 2019-05-19 05:13:50 |
| Whey | ʜᴀᴠᴇ ᴀ ɴɪᴄᴇ ᴡᴇᴇᴋᴇɴᴅ! | 2019-05-16 21:27:39 |
| IJexol™I | Jelleta <<<<<<<<<<<<< Zamasu | 2019-05-15 07:34:14 |
| KSV_SaiyanBlade | Any other DB Villian > Goku Black | 2019-05-15 04:11:02 |
| Whey | Have a nice week | 2019-05-13 21:55:09 |
| nobody_move w8 | 3 my heart :) | 2019-05-12 13:17:29 |
| ann | too much nudes, can't handle it | 2019-05-12 02:17:17 |
| nobody_move w8 | 20k inc :3 thank you so much :) | 2019-05-11 13:06:25 |
| Tommy Black | Goku black > any other DB villian | 2019-05-11 09:52:54 |
| IJexol™I | So finally you embrace the magnificence that is a tea sipper in the body of your idol. | 2019-05-11 09:14:32 |
| nobody_move w8 | Wonderful Weekend my lovely friends | 2019-05-10 12:37:00 |
| Tommy Black | 5/9 GOKU and PICCOLO DAY! | 2019-05-09 17:07:04 |
| Whey | ʜᴀᴠᴇ ᴀ ɴɪᴄᴇ ᴡᴇᴇᴋ! | 2019-05-06 21:39:19 |
| nobody_move w8 | Happy Week #NbM | 2019-05-06 13:53:56 |
| Tommy Black | get off my profile then. unsub to my comment section. da ♥♥♥♥? | 2019-05-05 14:28:26 |
| Tommy Black | Yasmin > Jade > cloe > Sasha | 2019-05-05 14:14:08 |
| Tommy Black | https://www.facebook.com/BratzUK/?brand_redir=121139961248465 | 2019-05-05 14:13:14 |
| IJexol™I | Uh i just took a lucky guess and summarized the story from what i read on wikipedia. | 2019-05-05 08:08:34 |
| Tommy Black | #YasmineFTW | 2019-05-05 07:48:52 |
| Tommy Black | idk. It can just be kinda entertaining if ur looking to watch something. and You seem to know a lot about what goes on in the series. I bet u watch a bit of it too Which Brat is your favourite? | 2019-05-05 07:48:04 |
| IJexol™I | Yes, but why would you watch a show about a couple of FEMALE BRATS doing a beauty magazine war with episodes that have the same basic premace as Ninjago? | 2019-05-05 07:35:22 |
| Tommy Black | I would never play get bratz dolls, nor would I buy them. I only like there music and there eps are good too. It's actually good. It's not even that girly lol. I'm on ep 4 already | 2019-05-05 06:48:23 |
| IJexol™I | -rep plays with little artificial girls. | 2019-05-05 02:52:15 |
| Tommy Black | https://twitter.com/DbsHype/status/1124718439191310341 - Preview for Jiren V Goku English Dub. just a few more hours!!! | 2019-05-04 17:46:08 |
| Tommy Black | Thx KLangy. love me some girly music | 2019-05-04 12:29:56 |
| Klang | -rep got a mind of a little girl. Also he's a transgender | 2019-05-04 12:26:30 |
| Tommy Black | Whey if you're seeing this. click on the link, it's a good song, you may like it | 2019-05-04 12:15:20 |
| Tommy Black | Series is decent too | 2019-05-04 12:13:21 |
| Tommy Black | Bratz music > any other music | 2019-05-04 12:13:11 |
| Tommy Black | BEST song - https://www.youtube.com/watch?v=RFM_kTkpEwc&list=PLGW-l9fvDanqRlIXg_WO3RNbiqiqVBzt2&index=41&t=0s | 2019-05-04 12:12:43 |
| Whey | ʜᴀᴠᴇ ᴀ ɴɪᴄᴇ ᴡᴇᴇᴋᴇɴᴅ! | 2019-05-02 22:27:40 |
| Tommy Black | Game crashed. if you desktop, it will likely crash, and that's what happened to me. add me and we can do some 1v1's if u want | 2019-05-02 09:22:22 |
| k..... | bro why you leaving ysterday xenoverse 2 sfdssdfsd | 2019-05-02 09:09:19 |
| Lordass Murderer | +rep | 2019-05-01 05:35:18 |
| Tommy Black | No problem | 2019-04-30 17:04:39 |
| nobody_move w8 | Thanks alot | 2019-04-30 15:54:44 |
| Tommy Black | https://www.youtube.com/watch?v=NtfupvQ2sts - DUBBED Goku vs Jiren is happening on May the 5th! | 2019-04-30 12:30:12 |
| nobody_move w8 | Hey ;3 Happy Week #nbm | 2019-04-29 07:45:29 |
| KSV_SaiyanBlade | ▼ ◄ ▲ ► ▼ ◄ ▲ ► ▼ ◄ ▲ ► ▼ ◄ ▲ ► ▼ ◄ ▲ ▼ ◄ ▲ ► ▼ ◄ ▲ ► ▼ ◄▼ ◄ ▲ ► ▼ ◄ ▲ ► ▼ Sorry, I just dropped my bag of Doritos on this page. ▼ ◄ ▲ ► ▼ ◄ ▲ ► ▼ ◄ ▲ ► ▼ ◄ ▲ ► ▼ ◄ ▲ ▼ ◄ ▲ ► ▼ ◄ ▲ ► ▼ ◄▼ ◄ ▲ ► ▼ ◄ ▲ ► ▼◄ ▲ ► ▼ ◄ ▲ ► ▼ ◄ ▲ ► ▼ ◄ ▲ ► ▼ ◄ ▲ ▼ ◄ ▲ ► ▼ ◄ ▲ ► ▼ ◄▼ ◄ ▲ ► ▼ ◄ ▲ ► ▼◄ ▲ ► ▼ ◄ ▲ ► ▼ ◄┐( °ー ° )┌ | 2019-04-27 15:20:27 |
| Tommy Black | Rado ur a C U N T. go lick out your grans puss puss | 2019-04-27 14:01:17 |
| KSV_SaiyanBlade | -Rep | 2019-04-27 13:32:28 |
| »´ﮛćɧέŋĵą.✘ | follow insta if you want https://www.instagram.com/schenja_official https://steamcommunity.com/sharedfiles/filedetails/?id=416659534 | 2019-04-27 05:49:25 |
| serafina | nice profile | 2019-04-27 00:34:36 |
| BustNcaps | SR3 screenshots ftw | 2019-04-27 00:13:14 |
| IJexol™I | +Rep Swings In Every Way. | 2019-04-26 12:11:22 |
| Tommy Black | Thx rado | 2019-04-26 12:08:27 |
| KSV_SaiyanBlade | -REP | 2019-04-26 12:07:51 |
| Tommy Black | It's amazing btw. u should definitely play it again. dw granny's puss ain't in it this time, just her saggy nips and her dried up vag | 2019-04-26 11:58:32 |
| KSV_SaiyanBlade | I wont play ur stupid ugly game in roblox | 2019-04-26 11:57:41 |
| KSV_SaiyanBlade | Shut it , Barbie FanBoy | 2019-04-26 11:20:21 |
| Whey | ʜᴀᴠᴇ ᴀ ɴɪᴄᴇ ᴡᴇᴇᴋ! | 2019-04-22 20:53:10 |
| KSV_SaiyanBlade | Who invited ur garbo brother in the conversation | 2019-04-22 09:13:11 |
| KSV_SaiyanBlade | :/ | 2019-04-22 09:09:18 |
| KSV_SaiyanBlade | 2v1 wow | 2019-04-22 09:09:12 |
| Ghostie | the reason why i blocked that rat, he comes back months later | 2019-04-22 03:10:05 |
| Tommy Black | Shut the ♥♥♥♥ up and get your nine year old ass off the internet | 2019-04-21 20:01:12 |
| KSV_SaiyanBlade | Rude | 2019-04-21 11:24:15 |
| Tommy Black | Rado shut the ♥♥♥♥ up lol. I don't even know why you're on my profile randomly commenting random ♥♥♥♥. Da ♥♥♥♥... | 2019-04-20 19:33:00 |
| KSV_SaiyanBlade | Above Gay | 2019-04-20 15:56:44 |
| KSV_SaiyanBlade | Below gay | 2019-04-20 15:56:35 |
| IJexol™I | No U | 2019-04-20 13:16:35 |
| KSV_SaiyanBlade | above gay | 2019-04-20 09:03:23 |
| KSV_SaiyanBlade | Below gay | 2019-04-20 09:01:51 |
| Tommy Black | I don't even know who u are lol | 2019-04-20 03:14:54 |
| Azaliwe | Love u | 2019-04-20 02:37:50 |
| Cool Pita Boy | hey whey add me | 2019-04-20 01:46:49 |
| Shadow TTV | Have a Nice Weekend!❤️Happy easter❤️ | 2019-04-20 00:50:47 |
| Tommy Black | da ♥♥♥♥ u on about | 2019-04-19 18:47:23 |
| KSV_SaiyanBlade | Earthworm sally carrying diseases from florida to cali. | 2019-04-19 16:35:44 |
| Ghostie | also you little rat, you declined my friend request. | 2019-04-19 14:08:14 |
| Ghostie | ♥♥♥♥♥♥♥ hell whey you already wrote that | 2019-04-19 14:06:58 |
| Whey | ʜᴀᴠᴇ ᴀ ɴɪᴄᴇ ᴡᴇᴇᴋᴇɴᴅ! | 2019-04-18 22:24:40 |
| Ghostie | hey whey, are you a bot? | 2019-04-16 15:15:41 |
| Whey | ʜᴀᴠᴇ ᴀ ɴɪᴄᴇ ᴡᴇᴇᴋ! | 2019-04-15 21:29:21 |
| Tommy Black | Yeah, I love Dragonball so much. I'm glad you recognised it. Oh and Just remember you insulted me first, you came to my profile calling me a camper and a tunneler. So shut the ♥♥♥♥ you hypocritical ♥♥♥♥. I never forced you to set foot on this ''Dragonball ♥♥♥♥-hole''. You did it all on your own like a big boy. You stepped on territory which you can't handle, I'd run away like a good girl if I was you. and you survived my plays, good for you my man, so why the hell comment on my profile if I was easy. You make no sense, You're as deluded as the rest of these people who comment ♥♥♥♥ 'calling me out' on dbd for 'SUCH' trash and toxic plays. Now get off my weeby profile you retarded dweeb. Oh and I love how you changed your name to 'Myers Phobia' , Did I actually damage you from going against michaels or something? Are u okay buddy? I really hope my game dynamics didn't damage you internally. | 2019-04-14 18:12:09 |
| Doodle | well, it for sure isnt nice to insult random people either, maybe you are the one that should consider growing up and quit being a sassy 9 year old weeb. besides, I survived your cheap plays, there is no reason for me to ''cry''. So either you grow up and quit being a unloved d-bag that insults everyone without any reasons and answer me properly on my account, or you shut the hell up and continue being such. i for sure wont set another step in this dragonball infected sh*thole | 2019-04-14 17:58:31 |
| Tommy Black | You don't need to warn anyone. I'm pretty sure everyone on dbd knows I'm the biggest wanker on dbd, and that I'm a tunneling ♥♥♥♥. But coming on my profile just makes me think you're winging for attention just because I tunneled you. Grow up you ♥♥♥♥♥♥♥ baby. it says in your description that you are a nice survivor. I'm definitely sure going on people's profile isn't nice mate, nor does commenting prove anything, just shows you're the biggest crybaby. Now go in your corner and cry like the baby you are | 2019-04-14 16:15:31 |
| Doodle | ''keep crying buddy'', im not crying. im just warning everyone else | 2019-04-14 10:13:18 |
| Tommy Black | Keep crying buddy | 2019-04-13 22:03:05 |
| Doodle | -rep, camper and tunnler | 2019-04-13 21:56:58 |
| SΞT | тупой даун кемперНуб шлюхин | 2019-04-11 14:41:23 |
| Aitvaras | Camper | 2019-04-10 13:15:53 |
| Tommy Black | i told you to follow me to help Bill. Don't take your death out on me. I tried to help, but he tunneled you, so shutup lol | 2019-04-09 08:15:34 |
| байден | ♥♥♥♥♥♥♥ NOOBFRAMED 100 TIMES♥♥♥♥♥♥♥♥♥♥ NOOOB | 2019-04-09 08:06:36 |
| Whey | Have a nice week! | 2019-04-08 21:33:46 |
| Ghostie | morning cruise said he like dbd because he hates it. his favourite killer is leatherface because it is his worst killer | 2019-04-08 19:04:00 |
| ✪RYO#Rikudou | +rep trusted , kind , polite , and best friend (don't go wrong with him) | 2019-04-05 12:39:23 |
| Whey | ʜᴀᴠᴇ ᴀ ɴɪᴄᴇ ᴡᴇᴇᴋᴇɴᴅ! | 2019-04-04 21:21:28 |
| Stivanoo | +rep the best friends | 2019-04-03 14:11:55 |
| Steph S. | Thanks for adding me | 2019-04-01 19:48:24 |
| Tommy Black | from the Brit group m8 | 2019-03-27 11:51:00 |
| DodoFish | Who dis what friend requist me | 2019-03-27 10:42:45 |
| ann | +reps One of the nicest guys in da house, fun to talk to and you'll get along well with him. He is that kind of person whose you'll go to if you're feeling lonely. He's g8 m8 no w8 i'll r8 8/88 | 2019-03-23 11:34:12 |
| Whey | ʜᴀᴠᴇ ᴀ ɴɪᴄᴇ ᴡᴇᴇᴋᴇɴᴅ! | 2019-03-21 21:31:49 |
| Tommy Black | Me and my spino were molested by 50 of those schmokes | 2019-03-20 08:30:35 |
| Ghostie | Little schmokie went in your base and molested your dinos. I told you to lock your doors when hou log out | 2019-03-19 23:24:15 |
| Whey | ʜᴀᴠᴇ ᴀ ɴɪᴄᴇ ᴡᴇᴇᴋ! | 2019-03-18 21:28:51 |
| Whey | ʜᴀᴠᴇ ᴀ ɴɪᴄᴇ ᴡᴇᴇᴋᴇɴᴅ! | 2019-03-14 22:23:02 |
| Whey | Have a nice week! | 2019-03-11 21:33:24 |
| Tommy Black | Radooooooooooooooooooooooooooooooooooo no | 2019-03-03 10:48:05 |
| KSV_SaiyanBlade | -Rep Sending Scary games and maybe games that steal ur roblox account and steam. | 2019-03-03 10:47:18 |
| IJexol™I | +rep for gud luck. | 2019-02-28 10:35:27 |
| sajuuk | hell nah | 2019-02-28 03:36:28 |
| Tommy Black | Your Lord and Savior | 2019-02-28 02:03:39 |
| sajuuk | who this? | 2019-02-27 20:19:21 |
| Ghostie | #ToDaMan | 2019-02-17 20:09:38 |
| Tommy Black | #IStandWithVic | 2019-02-11 09:07:14 |
| Tommy Black | https://www.change.org/p/rooster-teeth-rehire-vic-mignogna-for-rwby?recruiter=656391887&utm_source=share_petition&utm_medium=twitter&utm_campaign=psf_combo_share_initial.pacific_post_sap_share_gmail_abi.gmail_abi&utm_term=psf_combo_share_abi.pacific_post_sap_share_gmail_abi.gmail_abi&recruited_by_id=d71004b0-cb8c-11e6-b091-d982ee7071ad - SIGN THIS! | 2019-02-11 08:30:29 |
| IJexol™I | No U | 2019-02-10 23:18:09 |
| Tommy Black | Best Vegeta moment IMO! https://www.youtube.com/watch?v=hr7j8G3rbmA | 2019-02-08 19:45:56 |
| Mr. Overkill 🌟 | Good friend + RESPECT!!!! | 2019-01-30 06:51:48 |
| Tommy Black | Finally got into the schedule of watching Dragonball Super again. I've watched 6 eps today. I'm currently at EP 75 (English DUB Ofc) | 2019-01-29 14:17:00 |
| Klang | Help me, this dude has tied me up and he's forcing me to comment. HELP ME | 2019-01-28 14:01:12 |
| russo | Fortnite account. | 2019-01-26 21:56:20 |
| |ツ-ColeTrunks | hey long time no see | 2019-01-26 19:31:20 |
| IJexol™I | O H Y E A H Y E A HO H Y E A H Y E A HO H Y E A H Y E A HO H Y E A H Y E A H | 2019-01-24 21:54:42 |
| Tommy Black | OH YEA YEA OH YEA YEA OH YEA YEA OH YEA YEA | 2019-01-24 12:32:36 |
| IJexol™I | M A X I M I L L I A N S R I S E U P | 2019-01-24 12:27:14 |
| Tommy Black | Oh Yeah Yeah | 2019-01-24 11:05:23 |
| IJexol™I | lmao if i was given a bag of chips to eat at the theater i would still see the movie and know what it was all about and all it's flaws. that's why i hate the latest ice age movies. | 2019-01-24 07:11:58 |
| Tommy Black | Yeah its really weird. I get alot people like that | 2019-01-24 04:09:06 |
| Ghostie | why is there soo many desperate neckbeards lurking on that ♥♥♥♥♥'s artwork too. Does this person write on everyon'e profile's to get attention. | 2019-01-24 03:24:25 |
| Ghostie | And that is 101% not your "sis" ommy | 2019-01-24 03:19:40 |
| Ghostie | bud you cared about the munch more than the movie. | 2019-01-24 03:18:22 |
| Tommy Black | Just came back from seeing @dragonballsuper Broly. What a great movie, had some major flaws, but it definitely turned out to be an amazing movie. definitely worth watching another million times. Thanks for such an amazing experience @ToeiAnimation ❤️ | 2019-01-23 15:44:38 |
| Tommy Black | Rate mine up to sis | 2019-01-23 08:01:52 |
| »´ﮛćɧέŋĵą.✘ | Rate this Artwork if you want https://steamcommunity.com/sharedfiles/filedetails/?id=416659534 | 2019-01-23 07:58:56 |
| Tommy Black | And if you didn't know, most twelve year olds use that quote as a comeback. so by using this, it just tells me you're a twelve year old baby. | 2019-01-23 04:33:01 |
| Tommy Black | They're* | 2019-01-23 04:30:49 |
| Tommy Black | English please. Before accusing me of any age, please consider reading the English Dictionary/Thesaurus. | 2019-01-23 04:29:58 |
| Arceus | Commenting the exact same thing makes it obvious that ur two 12 year olds who think theyre cool lol. | 2019-01-23 04:25:28 |
| Tommy Black | So what if we both comment on your crappy as profile. that doesn't mean ♥♥♥♥. Ya camping scumbag! | 2019-01-22 23:18:10 |
| Arceus | not swf but you both comment on my steam profile kys u fwcking cwnt no one on earth loves u lol | 2019-01-22 13:21:12 |
| Ghostie | jat a mean tho? | 2019-01-22 03:29:19 |
| Misaki The Ironic | you are awesome | 2019-01-20 10:27:05 |
| Borkyy | An awesome, diehard dragonball fan | 2019-01-20 10:05:15 |
| »´ﮛćɧέŋĵą.✘ | ʜᴇʟʟᴏ, ᴄᴀɴ ʏᴏᴜ ʟᴇᴀᴠᴇ ᴍᴇ 𝟼 ᴄᴏᴍᴍᴇɴᴛs ᴏɴ ᴛʜᴇ ᴘʀᴏғɪʟᴇ, ᴘʟᴇᴀsᴇ? ᴛʜᴀɴᴋs ᴀɴᴅ ʜᴀᴠᴇ ᴀ ɴɪᴄᴇ ᴅᴀʏ! | 2019-01-20 10:03:05 |
| Jumbo Potatoes | friendly and good profile +rep | 2019-01-19 23:13:11 |
| :) Keep Smiling | good killer !!! | 2019-01-19 21:38:47 |
| CannabrosYT | sup | 2019-01-19 03:30:29 |
| Princess Zelda ▲ | .| : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : :”-'\,, ..\: : : : : : : : : : :'\: : : : : : : : : : : : : :~,,: : : : : : : : : “~-.,_ ...\ : : : : : : : : : : :\: /: : : : : : : : : : : : : : : “,: : : : : : : : : : :"~,_ ... .\: : : : : : : : : : :\|: : : : : : : : :_._ : : : : : : \: : : : : : : : : : : : :”- . ... ...\: : : : : : : : : : \: : : : : : : : ( ) : : : : : : \: : : : : : : : : : : : : : '\._ ... ... .\ : : : : : : : : : '\': : : : : : : :"*": : : : : : : :|: : : : : : : : : : : : : : : |) ... ... ...\ : : : : : : : : : '\: : : : : : : : : : : : : : : :/: : : : : : : : : : : : : : : /"" ... ... .....\ : : : : : : : : : \: : : : : : : : : : : : : ,-“: : : : : : : : : : : : : : : :/ ... ... ... ...\ : : : : : : : : : \: : : : : : : : : _=" : : : : : ',_.: : : : : : : :,-“ ... ... ... ... \,: : : : : : : : : \: :"”'~---~”" : : : : : : : : : : : : = :"”~~ | 2019-01-19 02:26:15 |
| Leex | Thats my boi | 2019-01-18 13:51:26 |
| »´ﮛćɧέŋĵą.✘ | Have a good weekend | 2019-01-18 06:54:29 |
| »´ﮛćɧέŋĵą.✘ | Have a nice day :) | 2019-01-16 15:04:25 |
| »´ﮛćɧέŋĵą.✘ | Have an awesome weekend! | 2019-01-12 07:42:51 |
| »´ﮛćɧέŋĵą.✘ | Hi, Can you sign my profile ? Have a good day | 2019-01-08 04:03:30 |
| IJexol™I | k much better pic now... and btw you should really check out resident evil 4 with the mouse gun pointing mod (cuz apparently to aim with the gun you have to use your keyboard and not your mouse, but the game is very highly praised) | 2019-01-07 00:29:00 |
| SkooLL | hαvє α grєαt dαч! | 2019-01-05 14:57:40 |
| Lesu from Palas | FREE CSGO COMMENDS https://discord.gg/5Ef6yG2 | 2019-01-03 06:59:31 |
| Tommy Black | Yeh lol. | 2018-12-25 13:01:47 |
| IJexol™I | Merry happy to u 2. although wishing yourself a merry happy is N A U G H T E H . | 2018-12-25 06:06:45 |
| Tommy Black | Merry xmas to myself! | 2018-12-24 23:26:16 |
| IJexol™I | +repperino Bestest Friend. | 2018-12-16 11:26:39 |
| Tommy Black | **BOOKED to see the DBS Broly movie** #23rdJanuaryHype - https://twitter.com/TommyTucker915/status/1073589324426420224 | 2018-12-14 09:00:56 |
| Tommy Black | 20MINS UNTIL TRAILER 3 DROPS! MY BALLS ARE READY | 2018-11-07 16:41:15 |
| Tommy Black | https://www.youtube.com/watch?v=XYWQcv-MpY4 - EPICERINO! | 2018-11-06 15:55:03 |
| nobody_move w8 | Thank you :) | 2018-10-16 14:16:52 |
| xyos | +rep nice Profiel | 2018-10-16 05:26:27 |
| Lynx | +rep | 2018-10-14 07:03:01 |
| Tommy Black | HeyY. Nice to meet you too | 2018-10-14 06:01:15 |
| nobody_move w8 | Hello! i wish you a awesome/lovely weekend! | 2018-10-13 10:50:25 |
| nobody_move w8 | much love! | 2018-10-12 06:02:56 |
| nobody_move w8 | @nobody_move | 2018-10-10 10:28:08 |
| Tommy Black | I love it Klangy | 2018-10-09 13:45:40 |
| Klang | Do you like your dbs dildo that I bought you? I think it's too large but I hope you still like it :) | 2018-10-09 13:37:32 |
| nobody_move w8 | nice heh | 2018-10-09 09:32:37 |
| nobody_move w8 | we are family ! much love | 2018-10-09 04:41:13 |
| nobody_move w8 | I will be glad to help you / I wish u a awesome week / more loves! | 2018-10-07 15:29:33 |
| ᴛᴇɴᴅᴏʟʏɴ♡ | profile takes me me back to my childhood. | 2018-10-07 14:00:39 |
| Ghostie | currently asleep listening to sad music | 2018-10-05 16:25:09 |
| nobody_move w8 | I'm here! | 2018-10-05 13:42:53 |
| Klang | Yes | 2018-10-05 13:37:21 |
| IJexol™I | Klang did rado replace your brain with a football? | 2018-10-05 13:30:57 |
| Klang | The worst steam account ever >:(. This dude scammed me with a snicker and he deserves to DIE in hell. Rado should've hacked you >:( | 2018-10-05 13:29:12 |
| nobody_move w8 | God dag / Hola / Hello / Привет / 今日は / Ola! / Dobrý नमस्ते / Bonjour / Привіт / Selam / Siema / 侬好 / Ciao | 2018-10-04 12:55:27 |
| nobody_move w8 | You have chance :) road to 50% /100% - 10 000comments) | 2018-10-03 11:28:00 |
| nobody_move w8 | hello,say- hello world haha) @nobody_move @besedka(dream 10 000com) | 2018-10-02 11:57:52 |
| Sexy Ace | he's a proud wearer of the golden chasity cage | 2018-10-01 14:30:18 |
| z0ne | No your wrong I never deleted you. We were kinda close you know? F it added u. | 2018-10-01 13:10:51 |
| Tillimo | +rep <3 really good team player and courteous guy | 2018-10-01 11:58:57 |
| nobody_move w8 | Hey@nobody_move@besedka have a nice day❤ 25% /100% (10 000comments) | 2018-10-01 10:21:46 |
| Tommy Black | Zone, you deleted me lol. I never removed you. I rarely remove people from my friends list unless they piss me off or I just don't like them. but for you, No I never deleted you. You must of done it. | 2018-10-01 06:22:44 |
| z0ne | I see you have unfriended me, thats cool. | 2018-09-29 17:36:15 |
| lily | word on roads ur a dirty nonce | 2018-09-29 14:21:16 |
| nobody_move w8 | How Your weekend?What are You doing?Got Fun? i have awesome weekend ❤ my dream is 24% /100% (10 000comments) | 2018-09-29 10:56:01 |
| Cool Pita Boy | pitttttttttttaaaaaaaaaaa | 2018-09-29 09:45:55 |
| Cool Pita Boy | weeb | 2018-09-29 09:45:04 |
| Ghostie | gg. | 2018-09-29 04:28:28 |
| Tommy Black | I would like to also wish you an amazing weekend | 2018-09-28 11:09:29 |
| nobody_move w8 | Hello,i wish you a good weekend. (my dream 20% /100% - 10 000comments) | 2018-09-28 09:46:18 |
| Klang | This offends me as a vegan transgender hipster Native-American-Indo-Chinese hybrid alien agnostic-atheist German engineer who vapes fairtrade organic decaffeinated compressed and hydrated extra-protein soy breast milk on the regular and does Hindi Kama Sutra naked crossfit yoga 5 times per week. I'm also a nonbinary trigender genderqueer male feminist and identify myself as a pastafarian pansexual genderfluid Apache helicopter dog of mega multi alpha beta gamma delta omega combo god of hyper death who's in a polygamous polyamorous relationship to the chihuahua which helped me cross the border of Mexico because it hates Donald Trump. My dog also walks me to the park and doggy styles me, if you find that weird you're an ignorant arrogant homophobic gender-assuming globaphobic bloodthirsty gun-loving cisgender pansexual bestial sexist racist incestuous white-previlege misogynistic biased objectified raped privileged Nazi slave owner terrorist lesbian. | 2018-09-25 13:42:56 |
| Leex | +rep Go ♥♥♥♥ yourself mate | 2018-09-12 17:19:57 |
| -raidnician. | +REP NİCE PROFİLE | 2018-09-12 12:01:17 |
| IJexol™I | +rep really good at xenoverse. | 2018-09-10 23:24:57 |
| KSV_SaiyanBlade | +rep. Amazing friend. | 2018-09-10 14:59:08 |
| Tommy Black | Eyy. there is no need for that rudness Rado. | 2018-09-10 12:01:36 |
| Kraken | I and my friends usually do 2v2s so i hope u can join us sometimes. XV2 | 2018-09-09 11:17:32 |
| Greasewoah | That sounds gay but ok | 2018-09-08 10:42:32 |
| Tommy Black | For xeno fights. | 2018-09-08 10:40:48 |
| Greasewoah | Who tf r u and y friend me | 2018-09-08 10:32:22 |
| huze4k | +rep good player | 2018-09-07 12:50:27 |
| Tommy Black | Just ♥♥♥♥ off you dumb kid. | 2018-09-07 11:59:11 |
| IJexol™I | oh yea. this sure is a game for toxic ♥♥♥♥ being salty. | 2018-09-03 11:42:53 |
| Tommy Black | The comments are what feeds me through these dark times on DBD. without them, well I wouldn't be where I am today. #SaltCommentsFTW | 2018-09-03 11:19:03 |
| IJexol™I | wow tom what's up with all this bad rep from the community? and that's exactly why you should only play with friends for maximumer fun. | 2018-09-03 10:36:57 |
| The Diesel | Ragequit! | 2018-09-03 10:16:04 |
| Vuunk | RageQuit ? | 2018-09-03 10:15:34 |
| Nie pytaj | -rep killer leaver at start of match burning offerings of everyone. Just an ♥♥♥♥♥♥♥. | 2018-09-03 09:11:33 |
| Tommy Black | You're feeding me Derepilos | 2018-09-03 09:06:51 |
| Dere | camper noob | 2018-09-03 09:04:10 |
| ARBD | The hell did i miss? | 2018-09-03 07:49:33 |
| Samakin | Nice! | 2018-09-03 05:51:04 |
| Tommy Black | xeno too if ya want | 2018-09-03 05:47:58 |
| Samakin | Oh. Well I didn't do it, just found it online and really like it, but if you have FighterZ, we can play together. | 2018-09-03 05:44:39 |
| Tommy Black | Picture looks awesome! | 2018-09-03 05:40:48 |
| Samakin | May i ask before i do anything, why did you send a friend request? | 2018-09-03 05:01:38 |
| Tommy Black | Here is fine. And idk what u mean gbh | 2018-09-02 14:43:53 |
| KSV_SaiyanBlade | can i talk on on private cuz my hand is hurting from refreshing | 2018-09-02 14:42:58 |
| KSV_SaiyanBlade | its not that | 2018-09-02 14:42:34 |
| Tommy Black | No I didn't. Morning is real | 2018-09-02 14:41:48 |
| KSV_SaiyanBlade | :/ | 2018-09-02 14:41:37 |
| KSV_SaiyanBlade | morning | 2018-09-02 14:41:02 |
| Tommy Black | Lie about what | 2018-09-02 14:40:28 |
| KSV_SaiyanBlade | :/ | 2018-09-02 14:40:18 |
| KSV_SaiyanBlade | Why did you lie? | 2018-09-02 14:40:09 |
| Tommy Black | What? | 2018-09-02 14:38:30 |
| KSV_SaiyanBlade | can i ask you something pls | 2018-09-02 14:32:37 |
| ARBD | Leave tommy alone. He play's how he wants. | 2018-08-31 12:45:26 |
| Ember | -rep Camping , Tunneling , Using Noed on Myers ;) | 2018-08-31 12:26:40 |
| IJexol™I | well they planned 2 fights in 2 different states and the money for 1 fight goes to ksi and the money for the other fight goes to logan paul. | 2018-08-31 01:37:20 |
| Tommy Black | No they didn't lmao. If u actually watched their 3 month old bids ur soon realise you're 100% wrong. Way before the fight they had to sign a contract/agreement. And in those terms were 'Rematch' which means they can rematch eachother after the fight if they wanted to. So yea | 2018-08-31 01:27:03 |
| IJexol™I | We're talking about how a rematch was scripted for ksi and logan paul, since they planned for 2 fights to happen. | 2018-08-31 00:57:28 |
| ARBD | What the hell is going on here? | 2018-08-30 13:55:17 |
| IJexol™I | true true. big waste. | 2018-08-30 13:08:28 |
| Klang | The Logan vs KSI fight was a waste of time | 2018-08-30 12:58:37 |
| Tommy Black | It will never receed chavkesh | 2018-08-30 12:24:16 |
| Sexy Ace | Hokus pokus bambel beece, may your hairline receed | 2018-08-30 12:03:11 |
| Mély | - rep Camper | 2018-08-30 08:11:28 |
| Sexy Ace | you're quite the receeder yourself | 2018-08-29 17:20:00 |
| ARBD | "♥♥♥♥♥♥♥" Oh i love you Vibacks. Please, Feed me | 2018-08-28 11:52:12 |
| Tommy Black | Love that salt ViBacks and Shank | 2018-08-28 11:45:59 |
| ARBD | So stop whining and leave Tommy alone. | 2018-08-28 11:44:07 |
| ARBD | People camp everywhere, just because it's a "PTB" Doesn't mean you have to be a nice Killer | 2018-08-28 11:43:46 |
| IJexol™I | that's called "just as planned" | 2018-08-28 11:31:56 |
| Daiv | ♥♥♥♥♥♥♥ | 2018-08-28 11:31:12 |
| shank | Are you seriously camping on the ♥♥♥♥♥♥♥ PTB? What is wrong with you. | 2018-08-28 11:30:38 |
| ARBD | Ugh | 2018-08-26 13:58:56 |
| Tommy Black | AND THIS TIME. In Fricking LA. Logan will destroy that ♥♥♥ nog | 2018-08-26 12:01:55 |
| Tommy Black | Logan imo was the winner. But even if ksi or logan won. There would of been a rematch. Both of them agreed to one anyway | 2018-08-26 11:56:26 |
| IJexol™I | it's just a set up for future money making opportunities. aka rematches. | 2018-08-26 06:26:35 |
| ARBD | Seriously? Neither of them cant win a SINGLE game. Just a tie? | 2018-08-26 06:19:59 |
| Tommy Black | LOGAN AND KSI TIE ON THEIR 6TH ROUND! | 2018-08-26 02:52:37 |
| Tommy Black | JAKE WINS AGAINST DEJI 5TH ROUND! | 2018-08-25 15:25:28 |
| IJexol™I | oh idk what techniques deji has in store, but i know for sure jake paul's mind cannot predict that ♥♥♥♥. | 2018-08-25 03:28:31 |
| Tommy Black | Judging from his body. He's 99.9% gonna get toasted | 2018-08-25 01:13:46 |
| Tommy Black | Logan Paul Vs KSI. Deji vs Jake Paul | 2018-08-25 01:13:05 |
| IJexol™I | Hope deji wins today. | 2018-08-25 01:12:52 |
| Tommy Black | IT'S FIGHT DAY! | 2018-08-25 01:12:24 |
| ARBD | #ReleaseTheSaltySurvivors | 2018-08-24 04:28:58 |
| Kura | Long time no see | 2018-08-23 23:20:17 |
| Tommy Black | #ReleaseTheSalt | 2018-08-23 08:58:26 |
| ARBD | Oh, it's basically fnaf with all the Animatronics at once. (Except you can customize which ones are active and how agressive they are) | 2018-08-21 15:46:31 |
| Tommy Black | Nope. Never heard of it | 2018-08-21 15:20:04 |
| ARBD | I've been enjoying Ultimate Custom Night so far. Have you tried it yet? | 2018-08-21 14:54:45 |
| ARBD | Fair enough. | 2018-08-21 14:50:08 |
| Tommy Black | For me. It's Logan. Idk but he seems so much more genuine | 2018-08-21 14:48:37 |
| ARBD | If i was to pick one to support, Would have to be KSI. | 2018-08-21 14:39:50 |
| ARBD | Damn, lol | 2018-08-21 14:38:16 |
| Tommy Black | well they haven't even fought yet, so yea they're are still on this ♥♥♥♥. | 2018-08-21 14:21:03 |
| ARBD | You serious? KSI and Logan are still at that crap? | 2018-08-21 13:54:06 |
| TheAnthony | + Nice Profile <3 | 2018-08-19 13:09:15 |
| Sexy Ace | AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA | 2018-08-15 16:06:30 |
| Kura | DBS is dead until the movie | 2018-08-12 17:24:12 |
| Blackloch° | Hey Tommy, thanks for the invite and well met! | 2018-08-10 07:35:59 |
| KSV_SaiyanBlade | Tommy is bad person -rep | 2018-08-09 22:53:36 |
| IJexol™I | lmao videogames really do cause bad consequences. you had an option to pick one of all the different flavors and you chose to be salty. | 2018-08-09 09:25:07 |
| Legacy meg is OP | i am gonna facecamp if u gonna get in 1 rank noob( PS U NEVER GET 1 RANK BECAUSE U ARE NOOB WITH BABY 200 HOURS) | 2018-08-09 09:00:42 |
| Legacy meg is OP | -rep | 2018-08-09 08:56:57 |
| Legacy meg is OP | omg noob survivor who farm with killer and bodyblock windows and paallets to get kill for her. Report for working with killer and farm points with him | 2018-08-09 08:56:49 |
| Ghostie | is it not, naa? | 2018-08-08 03:58:04 |
| Tommy Black | https://www.youtube.com/watch?v=w_A6aiEOjF8 | 2018-08-04 14:20:35 |
| IJexol™I | nice mutant dog lol. | 2018-08-01 08:35:18 |
| IJexol™I | Wait, ZELDA IS A FUTA? | 2018-08-01 04:16:07 |
| KSV_SaiyanBlade | One, two, Zelda's coming for you.Three, four, Tommy need his lock your door Five, six, grab a crucifix.Seven, eight, Tommy better stay awake.Nine, ten, Zelda's back again. | 2018-07-31 19:34:22 |
| KSV_SaiyanBlade | :O | 2018-07-31 17:19:19 |
| IJexol™I | related to rado | 2018-07-30 13:00:08 |
| IJexol™I | you know you never actually had "tell me why you added me" in your profile. and i just want to fight you and test if you are real strong. i mean we are gonna have 2v2s with shego and tom right? we can discuss this further in the dms. | 2018-07-30 12:59:45 |
| KSV_SaiyanBlade | -_- | 2018-07-30 12:11:24 |
| IJexol™I | ain't a dumb enough reason tho. | 2018-07-30 07:13:50 |
| KSV_SaiyanBlade | -.- | 2018-07-30 06:51:43 |
| IJexol™I | because i wanna play xenoverse 2 with you. i am longing for a good challenger. | 2018-07-30 00:55:33 |
| KSV_SaiyanBlade | Jexol why you sent me friend reguest | 2018-07-29 17:27:22 |
| IJexol™I | +rep really good friend who will help ya out with having some fun. | 2018-07-29 02:24:12 |
| Princess Baddie Jade | Crazy ♥♥♥♥♥♥♥♥♥♥♥♥. that's all this ♥♥♥♥♥ has to say | 2018-07-25 14:58:53 |
| Tommy Black | Ikr. | 2018-07-25 14:48:07 |
| Leex | Signed by 𝕷𝖊𝖊𝖝 | 2018-07-24 14:32:09 |
| KSV_SaiyanBlade | Hola,que hacen | 2018-07-23 22:20:54 |
| Tommy Black | Scared of what? I didn't realise I intimidated you. oh well, Have a good day. | 2018-07-23 11:02:34 |
| ARBD | Oh, i'm so scaaaared. | 2018-07-23 07:48:33 |
| Tommy Black | What's more funny is seeing you STILL comment here. What u come out with is PURE cringe, it's funny how you were attacking the weebs but you're just the same as them. You comment ♥♥♥♥♥♥ crap and you STALK me. Like instead of stalking my profile and reading the ♥♥♥♥, why don't u do something far better. Get a a job and find a girlfriend. How does that sound Alex? | 2018-07-23 06:31:15 |
| ARBD | XD | 2018-07-23 06:19:12 |
| Klang | I know xD | 2018-07-23 06:18:38 |
| ARBD | This is so funny to read. | 2018-07-23 06:17:01 |
| Klang | How am I stupid. Stupid is a strong word and you're not allowed to use it my special little princess | 2018-07-23 06:16:31 |
| KSV_SaiyanBlade | I don’t know what makes you so stupid, but it really works. Mr Klang | 2018-07-23 01:01:17 |
| Klang | Shut tf up rado u 9 year old spaghetti looking dude. I'll rek ur @-hole like I did with Piccolo's dragon ballz | 2018-07-22 18:12:16 |
| Princess Baddie Jade | I am the Super namekian! | 2018-07-21 13:49:11 |
| Tommy Black | He is | 2018-07-20 23:11:31 |
| Tommy Black | Da ♥♥♥♥. Why are you still commenting if u deleted me lol. Quote from you. "I'm just gonna move on". Well Cleary you are...I mean removing the subscribtion from my comment section helps. | 2018-07-20 22:44:18 |
| KSV_SaiyanBlade | ok | 2018-07-16 08:47:35 |
| ARBD | 12 Comments! Yay! Now i can read all the Comments That those weebs sent! | 2018-07-16 08:34:14 |
| Doin (Carter) | please calm down | 2018-07-16 00:41:16 |
| KSV_SaiyanBlade | +rep Good friend to play With. | 2018-07-15 21:57:17 |
| KSV_SaiyanBlade | Klang you are dumb ass | 2018-07-15 20:08:52 |
| Klang | And you're hella gay lol | 2018-07-15 20:00:16 |
| Tommy Black | that was hella random lol | 2018-07-15 18:04:25 |
| Klang | I didin't even know the controls, I thought you had to press space to jump. Go and play with Rado u weeb | 2018-07-15 16:41:00 |
| Tommy Black | Klang U are SOOOOOO bad at Rocket League. You suck ass bro. ''How do I jump'' - Klang2k18 | 2018-07-15 16:18:54 |
| Klang | And Tommy, you should suck Kempan's fat ginger weeb ♥♥♥♥ | 2018-07-15 16:07:50 |
| Klang | I'm the best player at rocket league | 2018-07-15 16:07:23 |
| Tommy Black | Klang go suck Kempan's ginger ♥♥♥♥ | 2018-07-15 13:48:09 |
| Klang | No the ni@@er ♥♥♥♥♥♥ | 2018-07-15 13:43:22 |
| Tommy Black | Ya'll gay asf | 2018-07-15 12:12:15 |
| ARBD | Klang the Fat Klang | 2018-07-15 09:08:48 |
| Klang | Tommy the fat tucker | 2018-07-15 08:04:33 |
| ARBD | How dare you call Tommy Fat! Gtfo out of here. | 2018-07-13 17:41:50 |
| Tommy Black | I will definitely stay healty, dw! Thanks for your concern man. Really helps me | 2018-07-13 15:11:06 |
| .IX | thanks man iam appreciated i wish you a great day! stay healty! | 2018-07-13 15:10:16 |
| Tommy Black | I am small, fat and don't have a girlfriend? ahahahaahahahahahaahahha, ok. I have no idea who you are and u come on my profile and say that. LMFAO. But hey, it's different. I've never seen anyone on steam do this, so I'll at least give u some sort of credit | 2018-07-13 15:07:37 |
| .IX | dude you are small and fat so yeah you dont even have a girlfriend you virgin so dont talk with a chad like me OKAY | 2018-07-13 15:04:49 |
| Tommy Black | Sorry for thrashing you :) | 2018-07-13 09:33:24 |
| .IX | piece of **** | 2018-07-13 08:46:42 |
| Burak Yazıcı | It was so much fun to play with you my brother accomplished in rocket league :) | 2018-07-13 06:59:05 |
| Ghostie | my favourite phsyco | 2018-07-09 13:22:19 |
| Sexy Ace | it's not the psycho path. that sounds like a street name | 2018-07-07 08:16:17 |
| Sexy Ace | Psychopath is one word | 2018-07-07 08:16:01 |
| Tommy Black | ty | 2018-07-07 01:27:45 |
| Greasewoah | Who is this person whom cannot spell psycho correctly but insults someone over "your" and "you're | 2018-07-06 17:33:35 |
| Tommy Black | Your Homocide killer! | 2018-07-06 09:08:52 |
| Sexy Ace | who is this MYSTERIOUS stranger on my friendslist?! | 2018-07-06 08:32:55 |
| ARBD | Wow, this is quite the show. | 2018-07-05 14:07:39 |
| Tommy Black | 100 pressups and I'll let you suck my HUGE ♥♥♥♥. deal? | 2018-07-05 11:51:09 |
| serafina | you are a peice of ♥♥♥♥ mate. i hope you die slowly | 2018-07-05 09:46:50 |
| Tommy Black | Just gotta say one thing to the British people here. IT'S COMING HOME!!!! | 2018-07-04 13:30:58 |
| ARBD | Problem Solved i guess. | 2018-07-04 11:10:21 |
| Tommy Black | idk. Well I accepted now anyways. | 2018-07-04 06:25:14 |
| ARBD | Well, did he ever talk to you much? Or did you ever talk to him much? | 2018-07-03 16:09:59 |
| RoBBiN | Thats lame lol | 2018-07-03 15:31:35 |
| ARBD | No idea, Most likely because he got bored of you. No offence. | 2018-07-03 09:22:05 |
| RoBBiN | Hey man why did you unfriend me ? I just changed my name and i cant play xenoverse anymore on this screen cause its to crap | 2018-07-03 06:16:25 |
| ARBD | +rep said i aint allowed to do anything XD | 2018-06-30 11:17:26 |
| MacMerks | +rep dude helped with an achievement on tomb raider (2013) and he likes DBZ :P | 2018-06-30 11:03:40 |
| Tommy Black | You ain't allowed to do such a thing Alex. I'm sorry | 2018-06-30 10:49:11 |
| ARBD | <333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333 <3 | 2018-06-30 10:25:53 |
| Tommy Black | <3 | 2018-06-30 06:58:02 |
| ARBD | So Negative. | 2018-06-29 18:14:33 |
| Tommy Black | Adi get off my profile with that crap lol. | 2018-06-29 16:49:22 |
| serafina | same with you doctor mate | 2018-06-29 16:46:23 |
| serafina | Maattttteeeeeeee shut the ♥♥♥♥ up lara croft mate or i will spank you with my cobra | 2018-06-29 16:46:08 |
| Tommy Black | OHHH and Tommy comes back to this, welp. Hey, Lara and Alex. chill abit lol. No need for this, be good to one another. | 2018-06-29 16:38:48 |
| ARBD | Welp, have fun. Doctor, OUT | 2018-06-29 15:43:53 |
| Ghostie | that is very cute lara croft. can we talk next? | 2018-06-29 15:43:23 |
| ARBD | XD | 2018-06-29 15:42:19 |
| ARBD | The Doctor shall inject you with "Chill out" antidote. | 2018-06-29 15:42:06 |
| ARBD | I'm not "Helping" These trolls at all if you were wondering, I am defending my friend. | 2018-06-29 15:41:11 |
| Ghostie | let me guess you also never heard these people on mic either? | 2018-06-29 15:39:59 |
| Ghostie | they are almost like the weebs back in the day | 2018-06-29 15:39:33 |
| Ghostie | tommy? tell me why you have 50 people here riding your 1 inch? | 2018-06-29 15:39:05 |
| Ghostie | dr doctor i love you okay? | 2018-06-29 15:37:55 |
| Ghostie | are you guys okay? i am here for all of you | 2018-06-29 15:37:44 |
| ARBD | Look, i'm just going to Ignore you. We obviously dont get along well. | 2018-06-29 15:33:49 |
| ARBD | And i met him months ago :/ | 2018-06-29 15:33:11 |
| Ghostie | deletes comments if it hurts his feelings | 2018-06-29 15:32:31 |
| ARBD | You want to see someone with no Life? Check God Howard's profile. Just saying | 2018-06-29 15:11:25 |
| ARBD | Wow, Chill the ♥♥♥♥ out. I didn't know. Jeez | 2018-06-29 15:06:12 |
| ARBD | Oh, i thought you were another one of those Pathetic people who have no Life. | 2018-06-29 14:31:19 |
| Sexy Ace | A famous explorer once said, that the extraordinary is in what we do, not who we are. I'd finally set out to make my mark; to find adventure. But instead adventure found me. In our darkest moments, when life flashes before us, we find something; Something that keeps us going. Something that pushes us. | 2018-06-29 14:19:07 |
| Ghostie | A famous explorer once said, that the extraordinary is in what we do, not who we are. I'd finally set out to make my mark; to find adventure. But instead adventure found me. In our darkest moments, when life flashes before us, we find something; Something that keeps us going. Something that pushes us. | 2018-06-29 14:02:09 |
| Ghostie | A famous explorer once said, that the extraordinary is in what we do, not who we are. I'd finally set out to make my mark; to find adventure. But instead adventure found me. In our darkest moments, when life flashes before us, we find something; Something that keeps us going. Something that pushes us. | 2018-06-29 14:02:03 |
| Ghostie | A famous explorer once said, that the extraordinary is in what we do, not who we are. I'd finally set out to make my mark; to find adventure. But instead adventure found me. In our darkest moments, when life flashes before us, we find something; Something that keeps us going. Something that pushes us. | 2018-06-29 14:02:00 |
| Ghostie | A famous explorer once said, that the extraordinary is in what we do, not who we are. I'd finally set out to make my mark; to find adventure. But instead adventure found me. In our darkest moments, when life flashes before us, we find something; Something that keeps us going. Something that pushes us. | 2018-06-29 14:01:57 |
| Ghostie | A famous explorer once said, that the extraordinary is in what we do, not who we are. I'd finally set out to make my mark; to find adventure. But instead adventure found me. In our darkest moments, when life flashes before us, we find something; Something that keeps us going. Something that pushes us. | 2018-06-29 14:01:54 |
| Ghostie | A famous explorer once said, that the extraordinary is in what we do, not who we are. I'd finally set out to make my mark; to find adventure. But instead adventure found me. In our darkest moments, when life flashes before us, we find something; Something that keeps us going. Something that pushes us. | 2018-06-29 14:01:52 |
| ARBD | Was that Comment meant to be Toxic? | 2018-06-29 12:58:46 |
| ARBD | :/ | 2018-06-29 12:23:30 |
| ARBD | While i haven't played the game. I agree, it does look cool on the vids of it. | 2018-06-26 16:07:54 |
| Tommy Black | Tomb raider is the best game ever. GOODNIGHT @everyone | 2018-06-26 15:43:24 |
| 🌹𝑹𝒐𝒔𝒂.♡ | im sorry, i didnt want to be rude/spamming, have a great day you and tommy | 2018-06-25 17:33:37 |
| Greasewoah | "If you're a very toxic person like me. Please do yourself a favour and write the most toxic thing ever on my comment section. I literally get a hard on everytime a toxic/salt bag writes a comment on my profile, cuz then I just own "Tommy says otherwise. See I'm VERY toxic I am constantly insulting Tommy for not being pp trained xd | 2018-06-25 17:33:32 |
| ARBD | Why cant you guys leave tommy alone? That goes for you as well "Dark Rose" Just ♥♥♥♥♥♥♥ move on and let us be. PLEASE. | 2018-06-25 17:30:52 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Well, keep on dancing | 2018-06-25 17:29:37 |
| Greasewoah | https://lh3.googleusercontent.com/-X5EEafoEgKE/WzFfEIutEYI/AAAAAAAAA-A/pJDRA5k8IIw0ewLlqXm1sY1svkA3p5DswCL0BGAYYCw/h288/2018-06-25.png | 2018-06-25 17:28:27 |
| Greasewoah | Not a villain, A r e t a r d | 2018-06-25 17:28:18 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Starlight isnt villain tho | 2018-06-25 17:24:55 |
| Greasewoah | You seem to think racism hurts me because you don't have anything else against me. | 2018-06-25 17:17:04 |
| ARBD | No one cares. | 2018-06-25 16:43:16 |
| Greasewoah | hey qtie want sum ♥♥♥ | 2018-06-25 16:03:41 |
| Tommy Black | I also heard his last relationship his so called 'Girlfriend' was cheating on him and apparently he didn't care. He just wanted to be with her. What a ♥♥♥♥♥♥♥ cuck Lmao | 2018-06-25 02:34:59 |
| ARBD | Oh lovely, God ♥♥♥♥♥♥♥ is here. | 2018-06-24 22:41:13 |
| Greasewoah | He quite literally is a cuck since he'll let woman 100% dominate the relationship. Just so he can have one | 2018-06-24 20:59:18 |
| Tommy Black | What a stupid ♥♥♥♥♥♥. You know what? I'd actually prefer it if he deleted/ stayed off my profile. I don't want cuck marks written over my profile. It's already bad having weeb. | 2018-06-24 20:51:20 |
| Greasewoah | Keep deleting your comments Retardlight it's funny how you challenge me to fight and the game recognizes you have mods on, probably OP asf mods. Then you storm into my profile and delete all your comments when you got bested | 2018-06-24 19:59:38 |
| cake | no u | 2018-06-24 16:12:24 |
| Tommy Black | Alex, as you can probably tell. These guys have literally no life. they stalk my comment thread all day. These guys just miss me too much, well its ashame I don't feel the same way about these weebs LMAO. #StayAwayFromWeeabos | 2018-06-24 16:06:17 |
| ARBD | Why dont you all Unsubscribe from the thread? Then this whole thing can be over. | 2018-06-24 16:04:09 |
| 🌹𝑹𝒐𝒔𝒂.♡ | y'all are edgy | 2018-06-24 15:54:38 |
| ARBD | Jesus, what a ♥♥♥♥ Show | 2018-06-24 15:54:14 |
| Tommy Black | Okay. I can kinda agree. BUT when you mistake your For ♥♥♥♥♥♥♥ You're. THATS NOT BEING LAZY. THATS you be mentally retarded. lel | 2018-06-24 15:53:42 |
| cake | who the ♥♥♥♥ gives a ♥♥♥♥ about ''gramar'' issues when writing a damn steam comment?Tryhard. | 2018-06-24 15:52:51 |
| Tommy Black | It's 'You're'. not ''Your''. Gramar issues as well as comeback issues lel | 2018-06-24 15:50:53 |
| cake | your one to talk | 2018-06-24 15:49:23 |
| Tommy Black | What a great insult lel. | 2018-06-24 15:48:45 |
| cake | ♥♥♥♥ off you ♥♥♥♥♥♥♥♥♥♥♥♥ ♥♥♥♥♥ | 2018-06-24 15:46:39 |
| Tommy Black | Unsubscribe you disgusting weeb. | 2018-06-24 15:45:41 |
| cake | y the ♥♥♥♥ did i get an notfication here | 2018-06-24 15:45:11 |
| Tommy Black | what does game time in the past 2 weeks have to do with anything? That still doesn't take out the fact you have no life lol. there is many other places to play games. or u could also just spend your time on steam and trolling other peeps. | 2018-06-24 15:44:43 |
| Tommy Black | Exactly that. Thanks for that info, it really made me get to know you more. | 2018-06-24 15:43:14 |
| Greasewoah | Sorry correction I sleep for 15 hours I troll for 2 and I fap for 5.2 | 2018-06-24 15:42:34 |
| Greasewoah | 25.3 hours past 2 weeksThat equates to 1.8 hours per day. I guess I sleep for 20 hours and troll for another 2 | 2018-06-24 15:42:01 |
| Tommy Black | Sleeping isn't having a life. You're just getting your energy back for another repeated day. game, troll, eat, sleep. REPEAT | 2018-06-24 15:39:54 |
| Greasewoah | Sorry I need to sleep and have a life | 2018-06-24 15:36:06 |
| Tommy Black | I'm just here re-theming my profile. (AS USUAL). but this one might have to stay for a GOOD while, but we'll have to see. All depends on how long I get bored of looking at it. | 2018-06-24 13:58:59 |
| ARBD | WHEREEEEEEE ARRRRRRRRRRRRRRRE THEEEEE SAAAAAAAAAAAAAAAAAALTY COMMMMMMMMMMMMENTS. | 2018-06-24 13:56:49 |
| Tommy Black | its panama getting their ass whooped by England. yo England is looking gud, they might actually win this year. We have so many good players this year, I'm really hoping to win! | 2018-06-24 10:32:40 |
| ARBD | And....What is that screenshot meant to be? | 2018-06-24 10:07:29 |
| ARBD | I think he gave up. | 2018-06-24 09:49:17 |
| ARBD | We love you God Howard! | 2018-06-23 23:01:16 |
| Tommy Black | I love these comments. thanks for arriving here God Howard. you came to the right place | 2018-06-23 23:00:29 |
| ARBD | You know what, Keep bringing those comments. Tommy loves them to bits. | 2018-06-23 22:46:53 |
| Greasewoah | Why don't you take you are Troll ass out of here. Got that? | 2018-06-23 20:05:56 |
| ARBD | Well you can take you're Troll ass out of here. Got that? | 2018-06-23 20:04:25 |
| Greasewoah | Because I enjoy being a t r o l l | 2018-06-23 19:43:28 |
| ARBD | So why are you bothering Tommy anyway? | 2018-06-23 19:36:39 |
| Greasewoah | I think you should be worried about my spelling more than my grammar because I added punctuation more times than I did correct words spelled | 2018-06-23 19:35:14 |
| Greasewoah | Lmao | 2018-06-23 19:34:08 |
| ARBD | "That was an quite rude" Wow | 2018-06-23 19:33:33 |
| Greasewoah | That was an quite rude wasn't it? | 2018-06-23 18:58:48 |
| ARBD | Also, go learn some grammar. | 2018-06-23 18:35:10 |
| ARBD | I've been waiting for this! | 2018-06-23 18:34:54 |
| Greasewoah | Your're mom supre gay ex dee bet u cant not pp trained xdd.tats wat u git for unfriendnot eben pp trainedd loolllll | 2018-06-23 18:10:03 |
| ARBD | :0 Wow. No salty comments. | 2018-06-23 10:25:42 |
| Tommy Black | Man, I'm just like you. Craving the salt. ahhahhahahahah | 2018-06-22 15:20:09 |
| ARBD | Where are the salty comments? BRING ME SALTY NOW! NOOOOOOOW | 2018-06-22 14:50:12 |
| ARBD | XD | 2018-06-22 08:57:51 |
| Tommy Black | It's all guud. I love these salty comments lmao. #BRINGMORECOMMENTS | 2018-06-22 08:36:54 |
| ARBD | For god sake. Sneaky Beef, Just leave tommy alone. Move on. | 2018-06-22 08:16:54 |
| Tommy Black | ahahahahahaahaaahaah. Hey, Sneaky Pot did I hurt your pathetic soul in the F13 forums? well, I'm really sorry if I did. Is there any way I can help you? If there is. Please hit the add button and we can resolve any issues. Thank you for your time Pothead. | 2018-06-22 04:45:48 |
| Oh Hi Mark | Autistic weeaboo | 2018-06-22 04:39:46 |
| Tommy Black | Yea. Finally lol. Maybe in a couple of days another swarm of weebs will make an appearance but for now it's all looking clean here | 2018-06-22 02:16:42 |
| ARBD | Looks like the complaining idiots who are butthurt about Tommy removing them have cleared out. Finally, Peace and quiet. | 2018-06-21 21:45:09 |
| Tommy Black | Eyyy. No problem my man. I'm glad I helped! | 2018-06-21 21:08:40 |
| ZeroDivide | +1rep. thanks for the twitter link to Friday the 13th post on them never adding new content. Really helped my decision on if I should buy it while its on sale or not. | 2018-06-21 19:38:38 |
| Princess Baddie Jade | Tommy very good freind. me no like to see you abuse him like that Morning angry!!! | 2018-06-21 15:39:28 |
| ARBD | What is your problem "Rest in Peace X" ? Just because he removed you doesn't mean you have to lash out. Just move on. | 2018-06-21 15:36:53 |
| ARBD | Agreed. | 2018-06-21 15:29:31 |
| Princess Baddie Jade | Tommy no weeb. you ♥♥♥♥♥♥. bye bye | 2018-06-21 15:28:07 |
| ARBD | Good morning! | 2018-06-21 15:27:29 |
| Mr. 91 | Tommy is legitimately a bigger weeb than me, but ok. Also, you prob do have "bopolar" headass. | 2018-06-21 15:27:23 |
| Princess Baddie Jade | Morning here. hello everyone! | 2018-06-21 15:27:11 |
| Ghostie | You guys are disgusting weebs. lay off Tommy's profile | 2018-06-21 07:47:00 |
| Tommy Black | It's funny. I didn't realise how much I meant to these people lmao. | 2018-06-21 07:04:03 |
| ARBD | I actually agree with tommy here. Just move on. | 2018-06-21 06:37:27 |
| Tommy Black | Bopolar lol. ahahaahhaaha. I've been called that by someone before and you know what you both had in common. you were both mentally deficient. Don't be like the rest of these butt hurt simpletons, going onto my profile because I unfriended you. LMFAO. | 2018-06-21 06:26:24 |
| Mr. 91 | you act all nice and then block me, calling me annoying tf. Bipolar ass | 2018-06-21 04:46:39 |
| Tommy Black | what? your personal stuff. What personal stuff did you even give out to me? lol | 2018-06-21 01:18:09 |
| Tommy Black | Good boy. Delete your contemptible comments. | 2018-06-20 15:04:04 |
| Tommy Black | Starlight are you aware of how pathetic you sound? | 2018-06-20 14:58:56 |
| Greasewoah | *desperately | 2018-06-20 10:08:53 |
| Greasewoah | So if tommy's wrong I'm getting massively cucked online and I desperate try to get ♥♥♥♥♥? | 2018-06-20 10:07:24 |
| Greasewoah | Though retardlight that's the only thing you have against me, and it isn't much, "♥♥♥♥♥♥". That's all you have against me. Every time you throw something else at me it's easily countered. Then you freak and state, "no u" in an "Intellectual manner" | 2018-06-20 09:54:48 |
| Greasewoah | That's the one thing we can agree on | 2018-06-20 09:51:05 |
| Greasewoah | Oh nice you're being racistmy heart h u r t s | 2018-06-20 09:50:06 |
| Tommy Black | Starlight please remove yourself from my comment section. At least Grease Woah doesn't get cucked online, nor is he ♥♥♥♥♥♥ up and so desperate for ♥♥♥♥♥ that he begs on their comment section. | 2018-06-20 09:50:05 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Hi ♥♥♥♥♥♥, please leave Tommy alone :) | 2018-06-20 09:48:20 |
| 🌹𝑹𝒐𝒔𝒂.♡ | https://i.gyazo.com/c731cb4f6170062dafa45602210b3cde.png | 2018-06-20 09:47:57 |
| Greasewoah | Nice one retardlight that's me telling him trollingly, "eat my ass out, have a ♥♥♥♥♥♥ day" | 2018-06-20 09:47:00 |
| 🌹𝑹𝒐𝒔𝒂.♡ | https://cdn.discordapp.com/attachments/372479080722989056/445397790802182145/GreaseWhoa.jpg | 2018-06-20 09:46:21 |
| Tommy Black | Oh, on a sidenote. So I also discovered that weebs are SUPER random, you definitely fit that trait. | 2018-06-20 09:45:29 |
| Tommy Black | I'd say whenever i get bored of my current theme. Usually within a couple or weeks or so. Also uploading isn't too long, nor is to find the right color which I need for my desired theme. Are you autistic or something, how is uploading GIFS even long? | 2018-06-20 09:44:41 |
| Greasewoah | "repeating quotes from the dbs sub"I was ironically screaming TATATATATATATATATATATATATA | 2018-06-20 09:44:20 |
| Greasewoah | "weeb? God, you more deluded than I imagined. Lemme explain to your low IQ ass what weeb means. Ok, so a weeb is someone who gives their entire heart to anime"Explain to me how much time you took to upload all those gifs and put them on your profile, then get a new prof picture, then find the achievements that are color coded blueThen tell me h o w often you do that | 2018-06-20 09:43:06 |
| 🌹𝑹𝒐𝒔𝒂.♡ | +rep cute pfp | 2018-06-20 09:42:54 |
| Tommy Black | so having a DBZ related profile means i'm a weeb? God, you're more deluded than I imagined. Lemme explain to your low IQ ass what weeb means. Ok, so a weeb is someone who gives their entire heart to anime and trys their best to fit in to the japanase culture. which is 100% you. I remember having a general disscusion with you and or you would say is japanese crap from the super SUB. like god man, I'm just tryn'a talk here. i don't wanna hear japanese crap, just English my man. Don't start calling me a weeb if you're the one repeating quotes from the DBS sub. I watch the English DUB only, I am not a weeb my boi. You're the only weeb here. | 2018-06-20 09:42:21 |
| Greasewoah | Wait weeb and boringd i d y o u n o t j u s t d e s cr i b e y o u r s e lfYour profile is filled with dragon ball ♥♥♥♥ and the closest thing I have is playing a dbz game*Hypocrisy intensifies | 2018-06-20 09:08:49 |
| Tommy Black | Dark. You were cool, but eh. the thing is, it got kinda boring lel. Nah that wasn't the reason. But I just wanted to remove everyone except the ones I know ALOT and the ones I talk to pretty much everyday. But no hate on you, you were a cool guy. | 2018-06-20 04:05:45 |
| ARBD | XD | 2018-06-20 03:20:38 |
| Tommy Black | I only kept the people on my steam friends who I actually liked/Played with. you were a weeb and boring, you had to go lol. same with the rest of the 200 people. Only got my pals from my discord server now. | 2018-06-20 01:22:55 |
| Greasewoah | ♥♥♥♥♥ my pride has been insulted, nowc e a s e | 2018-06-19 19:00:38 |
| Tommy Black | Sorry :( | 2018-06-19 15:31:37 |
| snake eater | Local homosexual deletes all of his mates | 2018-06-19 15:28:48 |
| Tommy Black | Elfgang told me to. | 2018-06-15 13:15:10 |
| Kura | y u do dis? | 2018-06-15 13:02:41 |
| Sexy Ace | Baked beans ♥♥♥♥♥♥ | 2018-06-15 12:48:19 |
| ARBD | Indeed... | 2018-06-12 16:12:40 |
| Tommy Black | RIP Friday the 13th. May 26th 2017 - June 11th 2018. | 2018-06-11 17:05:34 |
| Klang | Gay | 2018-06-11 13:45:15 |
| Tommy Black | https://www.youtube.com/watch?v=nYXYV256Rrw&feature=youtu.be - HYPE | 2018-06-10 16:59:03 |
| Tommy Black | We are one. | 2018-06-10 16:24:31 |
| ARBD | We never lie. Trruuuuuuust me. | 2018-06-10 16:23:34 |
| brawler | At least you're being honest. | 2018-06-10 16:22:04 |
| Tommy Black | YAY ALEX!!!! WE BOTH BE TOXIC TOGETHER!!!! | 2018-06-10 16:21:29 |
| ARBD | I'm toxic too! ALEX LOVES TOXIC COMMENTS! | 2018-06-10 16:20:46 |
| Tommy Black | I AM TOXIC. SO TOMMY LOVES TOXIC COMMENTS. THERE WE GO!!!! YAYAYYAYAYAYAYAYAYAYAYA | 2018-06-10 16:20:08 |
| ARBD | I'm not getting involved in this. | 2018-06-10 16:17:31 |
| brawler | Yeah, let's switch the topic cause you can't defend yourself. Hmm, if my comments bother you so much then delete them. | 2018-06-10 16:12:56 |
| Tommy Black | Indeed. Anyway, can I help you with anything else? Or are u done for now? Really hope you're done, your spam of messages is bothering me. Seeing 'Brawler' over my comment section is enough for me to Commit suicide. | 2018-06-10 14:34:19 |
| brawler | Being toxic is telling you to stop acting immature. Got it. Anybody who has a differing viewpoint than you is clearly a toxic little ♥♥♥♥♥♥. | 2018-06-10 14:27:57 |
| Tommy Black | Critisim isn't the word my Ex-friend. being toxic is what you were. You know the difference? | 2018-06-10 12:52:44 |
| brawler | Nah, not stalking, I'm just subbed to your comment section. Again, calling me a ♥♥♥♥♥♥ does nothing to help prove your point of not being toxic. Damn, this thing has really got to you. Kinda glad you're not on my list anymore cause who wants an immature ♥♥♥♥ who can't accept criticism to be their friend. | 2018-06-10 12:19:23 |
| Tommy Black | ahhahahahhaahhahahahahahah. the ♥♥♥♥♥♥ of Canada has returned. stalking my comments, ey? | 2018-06-10 12:14:57 |
| brawler | 'dumbasses in the forums believe I was the toxic one, but clearly not LMFAO.'Calling us dumbasses and claiming not to be toxic is sure an odd way to go about it. | 2018-06-10 12:09:10 |
| Tommy Black | Yeah. He's a salty little ♥♥♥♥♥. At least it isn't just me who thinks that way about him. All the dumbasses in the forums believe I was the toxic one, but clearly not LMFAO. | 2018-06-10 11:50:05 |
| Pootster | I've fought Justin before he is very bad and salty | 2018-06-10 11:41:57 |
| Sexy Ace | here's a comment so you can jerk off savely tonight. check your closet later tho | 2018-06-10 11:13:42 |
| Ghostie | What a ♥♥♥♥ | 2018-06-10 04:58:03 |
| snake eater | My boy Tommy sure loves to find some odd people to put on his profile. | 2018-06-09 03:49:01 |
| cake | #CatFish | 2018-06-09 03:17:19 |
| Samakin | Okay. Some people might fall for it though. | 2018-06-08 23:49:20 |
| Tommy Black | I'm not faking as Deji you imbecile. I just want him as my steam theme ya ♥♥♥♥♥♥. | 2018-06-08 22:33:09 |
| Samakin | Why are you fakeing as Deji??? | 2018-06-08 22:22:28 |
| Klang | This is the worst person ever!!! #HeShouldKillHimself | 2018-06-08 08:16:48 |
| Princess Zelda ▲ | This is the best person ever!!! #Ilove2SuckOndisGuysDicky | 2018-06-01 05:54:37 |
| serafina | johnny approves | 2018-05-30 11:03:10 |
| Kura | I want a gohan plush pillow legit | 2018-05-28 23:18:45 |
| hin min bushon | +rep nice profile | 2018-05-28 09:49:08 |
| Greasewoah | Alliteration at it's finest | 2018-05-27 10:56:54 |
| Sexy Ace | Don't forget the Picolo Penis Pump | 2018-05-27 10:40:14 |
| Ghostie | happy birthday tummTurtle911. You can get all the goku sex dolls, vegeta dildos and gohan body pillows you want now | 2018-05-27 10:32:23 |
| ARBD | Happy birthday! | 2018-05-27 10:23:52 |
| Sexy Ace | Happy birzday to u, modder yucker! You get the blessing of the holy cow for today! | 2018-05-27 10:04:29 |
| Greasewoah | Happy birthdaykid | 2018-05-27 10:00:51 |
| Klang | Happy birthday you little weeb | 2018-05-27 06:42:08 |
| Leex | Happy birthday bro | 2018-05-27 05:15:24 |
| Cool Pita Boy | Happy birthday to my seconded favourite Brit #HappyBirthdayWeeb | 2018-05-27 05:09:02 |
| BubbleBob | Happy BDay ♥♥♥♥♥ | 2018-05-27 05:06:12 |
| KempAn | Grattis på födelsedagen Tommy! | 2018-05-27 04:58:59 |
| Princess Zelda ▲ | Happy birthday tom | 2018-05-27 04:25:31 |
| cake | This is where i post in my birthday comment | 2018-05-27 03:52:55 |
| IJexol™I | i heard you wanted a bday comment, so H E R E I T I S. happy bday. | 2018-05-27 02:30:52 |
| Hyper Mania | Have a great and nice weekend | 2018-05-26 17:36:00 |
| Klang | I'm not gay, I'm straight from hell | 2018-05-26 17:26:33 |
| Kura | ;_; got some to spare Klang? | 2018-05-26 11:17:02 |
| Tommy Black | Since you're gay Klang. How much ♥♥♥♥ do you get? Loads since Kempan supplies you with it! | 2018-05-26 11:15:21 |
| Klang | How much ♥♥♥♥♥ do you get? Z E R O o o o 。 。 . . . | 2018-05-26 09:55:08 |
| Tommy Black | F13 is better ya ♥♥♥♥♥♥. | 2018-05-26 08:46:00 |
| Klang | #DBDFTW | 2018-05-26 08:32:57 |
| Tommy Black | Happy 1 Year anniversary of Friday The 13th to all you sweaty fans that has played this game. #MayBenBlessYou | 2018-05-26 00:13:30 |
| Klang | You're a big weeb but not as big as ben/kempan and andrew | 2018-05-25 01:05:47 |
| Sexy Ace | whoa you're a REAL friday the 13th backer?! damn. Can I get a autograph on my profile? | 2018-05-24 19:02:50 |
| Sexy Ace | Biggest weeb of them all | 2018-05-24 19:02:09 |
| Lightning | " You took my life... even killed Chi chi and Goten ! I'll never forgive you !!! " | 2018-05-21 02:59:26 |
| ARBD | Hola, Hola A Todos! | 2018-05-20 00:08:40 |
| Ghostie | "Hey nutgang, i created a new cage for you and this time it is based underwater. The underwater cage will contain water from the dirty sewer so infection may occur. It is designed to stop you from breathing and you will be constantly drowning but you will always get some air, but usually 1 second before death. I think i said everything to you now elfie. now be a bad boy again and i will put that hot iron ballgag in your mouth and the razor but plug up your ass" -Lord Ninder from Nindaria 2k18 | 2018-05-19 23:35:24 |
| Klang | Says the biggest weeb ever | 2018-05-19 08:15:49 |
| Tommy Black | ♥♥♥♥ guys. I am very sorry. Forgive me weeb max and super weeb max | 2018-05-19 08:15:10 |
| IJexol™I | His dingus has transformed to super saiyan rose | 2018-05-19 08:14:23 |
| Klang | This profile is very offensive and bad. Please delete this account or I'll call ninder | 2018-05-19 08:13:46 |
| brawler | +rep small ♥♥♥♥ | 2018-05-19 00:06:43 |
| L0WSHOT | +rep show ♥♥♥♥ | 2018-05-18 05:13:38 |
| Tcencho | +rep Kick-Ass Profile | 2018-05-17 04:05:59 |
| Tommy Black | "Finally... it's the day you'll take your final breath... Saiyan." - Goku Black | 2018-05-13 19:56:57 |
| Kura | I smell like Cheetos and depression | 2018-05-13 14:47:26 |
| Ghostie | Begged me to add coment here | 2018-05-13 14:44:56 |
| cake | +rep that profile tho | 2018-05-13 05:25:07 |
| cake | nu | 2018-05-09 13:26:48 |
| Tommy Black | ***INSERT REAL NAME*** | 2018-05-09 13:25:05 |
| cake | ew tommy | 2018-05-09 13:24:35 |
| Tommy Black | Why u ''ewwwing'' | 2018-05-09 13:23:54 |
| cake | ew wtf | 2018-05-09 13:23:20 |
| Tommy Black | add Xeno for ♥♥♥♥ pics. | 2018-05-09 13:21:21 |
| cake | gae | 2018-05-09 13:11:01 |
| Kura | Add me for tit pics | 2018-05-09 13:08:47 |
| Tommy Black | and with this body...I can do anything! | 2018-05-09 12:55:32 |
| cake | no u | 2018-05-09 12:54:50 |
| Tommy Black | it's the day you'll take your final breath... Saiyan. | 2018-05-09 12:53:51 |
| cake | i feel betrayed | 2018-05-09 12:52:37 |
| cake | ew | 2018-05-09 11:44:24 |
| Tommy Black | ew wtf | 2018-05-09 02:52:04 |
| cake | O heck | 2018-05-07 08:28:19 |
| Tommy Black | You're right. | 2018-05-07 08:27:56 |
| cake | Kindness is for the weak! | 2018-05-07 08:26:45 |
| Tommy Black | ey Xeno my boi, why the insults? everyone else here are being velly kind and now u call me a filthy ningen...wow man, thought we were friends | 2018-05-07 08:25:42 |
| Kura | He a good boy | 2018-05-07 08:12:52 |
| cake | Filthy ningen! | 2018-05-07 08:10:13 |
| laura ♡ | Nech mě | 2018-05-06 18:59:21 |
| cake | Pedophile confirmed! | 2018-05-04 11:56:30 |
| Tommy Black | ofc | 2018-05-02 20:52:43 |
| Kura | Senpai finally notices me~ | 2018-05-02 20:51:31 |
| Princess Zelda ▲ | Love you Tommmmmyyyyyy | 2018-04-30 21:31:03 |
| KSV_SaiyanBlade | Hello | 2018-04-30 18:04:06 |
| Greasewoah | Ladylike Phallus | 2018-04-30 17:31:43 |
| Kura | Feminine penis | 2018-04-30 17:23:58 |
| brawler | Lesbian ♥♥♥♥ | 2018-04-30 17:20:15 |
| Princess Zelda ▲ | juicy ♥♥♥♥ | 2018-04-30 09:17:54 |
| KSV_SaiyanBlade | Hello | 2018-04-29 13:13:46 |
| Ghostie | Perfect Cell is da best Villian! | 2018-04-28 14:37:19 |
| Kura | Chipotle cost me 3 pairs so its cool | 2018-04-26 15:34:35 |
| Greasewoah | Also no I usually jizz in my underwear so I change 5 times a day | 2018-04-26 15:23:24 |
| Greasewoah | Wasn't my damn choice it was a bet k | 2018-04-26 15:23:05 |
| Kura | You change your profile more than you change your underwear i bet | 2018-04-26 15:19:56 |
| Greasewoah | lies | 2018-04-26 15:13:35 |
| Princess Baddie Jade | Fapping to a girl masterbating is the least Gay, TRUST me. | 2018-04-26 15:10:33 |
| Greasewoah | Fapping to trap porn is the least gay thing there is. If you fap to gay porn, that's 2 guys, and that's 100% gay. If you fap to 'straight' porn, then that has a woman, sure, but you're also fapping to a guy, which makes it 50% gay. But a trap is like half male, half female, and thus a trap with a girl would add up to 75% girl, and thus only 25% gay. 2 women would be ideal, but that would be a lesbian relationship, which brings it around to gay again. Then there's consent. If a person doesn't consent to something, but the other person does it anyway, that makes the other person stronger, and thus less gay. Let's say that means they're about 50% less gay. If it was gay , that means that it's now 75% gay. If it's straight -blam!- by a man, then it's 25% gay. And, if it's trap gay porn, than that's 12.5% gay. So technically, yes, trap porn is the least gay porn there is, but that's still looped in with trap porn, hence why fapping to trap porn is the least gay thing there is. | 2018-04-26 15:09:31 |
| Greasewoah | K | 2018-04-26 15:08:29 |
| Princess Baddie Jade | @Everyone add this account. This is my secondary account. | 2018-04-26 15:07:40 |
| brawler | Fortnite is for ♥♥♥♥♥♥♥. | 2018-04-25 17:15:06 |
| Tommy Black | Black Black žan FTW. it's for my boi https://steamcommunity.com/profiles/76561198271845369 | 2018-04-25 11:30:44 |
| cake | ♥♥♥♥♥♥♥♥♥ | 2018-04-25 11:29:49 |
| brawler | ♥♥♥♥ | 2018-04-22 12:16:49 |
| cake | F*ck | 2018-04-22 12:06:21 |
| Tommy Black | I wouldn't say eradicted. The picture still remains in my personal drive. | 2018-04-22 10:55:27 |
| cake | good that pfp has offically been eradicated , subarashii | 2018-04-22 10:12:27 |
| Tommy Black | Yeah the 'Lusty Uncle' was ONY a meme lol. I enjoyed it while it lasted :D | 2018-04-22 07:04:34 |
| brawler | 'normal' | 2018-04-22 00:13:10 |
| Kura | Good to see your profile is back to normal lol | 2018-04-21 23:25:36 |
| Tommy Black | No, steam allows child rapists but they don't allow REGISTERED rapists. Valve for some reason has something against the registered ones. Don't ask me why. I'm just here on steam for the kiddies, nothing but those sweet young virgins. | 2018-04-19 02:13:12 |
| cake | Damn didnt know steam allowed child rapists | 2018-04-19 02:10:46 |
| Tommy Black | Where the kids at? | 2018-04-19 02:05:08 |
| Greasewoah | -rep Stole all my children that I worked hard for by offering them lolipops | 2018-04-18 21:45:29 |
| Tommy Black | I AM A FULL PEDO. OUT LOOKING FOR 10 AND BELOWS! I own a local store, I sell Plenty of candy for the children, please kids, come to this store and grab as much candy as you desire. | 2018-04-18 21:44:33 |
| brawler | + rep gave me a delicious lolipop. | 2018-04-18 17:23:08 |
| teh arcana is the means by whi | -rep Let me in his windowless white van but never gave me candy. | 2018-04-18 13:20:48 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Tommy, Vegeta is asking wtf you did with your profile? he is so mean... | 2018-04-18 08:44:20 |
| Kura | Ill take your virginity pain | 2018-04-18 08:37:28 |
| Princess Zelda ▲ | {\__/}(•__•)/___>8==D (•()•) | 2018-04-18 08:09:26 |
| Princess Zelda ▲ | Ya nasty | 2018-04-18 04:45:47 |
| Tommy Black | Didn't need to know that. | 2018-04-18 04:41:53 |
| Tommy Black | Older than me so you can rape me. | 2018-04-18 04:41:13 |
| Tommy Black | You look like a Sexual Predator yourself. | 2018-04-18 04:40:03 |
| brawler | Hot | 2018-04-17 17:39:34 |
| Greasewoah | I'm a registered lust offender | 2018-04-17 07:17:48 |
| Princess Baddie Jade | Morning scared of the lusty uncle | 2018-04-17 07:17:10 |
| Ghostie | beware of the lusty uncle | 2018-04-16 22:17:58 |
| Tommy Black | Just gonna warn everyone who's SUBBED to this comment section, gonna be blocking comments on my profile for a while (Maybe 2 weeks to a month) . so yea | 2018-04-11 18:00:57 |
| 🌹𝑹𝒐𝒔𝒂.♡ | *her eyes are turning black and she unleashes her Flame Wings* | 2018-04-11 17:59:53 |
| Kura | Legends say its still there | 2018-04-11 17:53:41 |
| Kura | Last week i got a chapstick stuck up my butt. | 2018-04-11 17:53:16 |
| Greasewoah | Well excuse me for sharing an interesting episode with u | 2018-04-11 17:45:44 |
| brawler | evgbjh6ybujbkimn7r6iy5erhghhyuef2y7grhugbfgbgufg68f4g7843bgybvfd78r32yugbgrbewf8d2332bvr3g7vg78f4bbfv7vr878f4bf4bg78fbfb gfeg788vbvfbds73bff438fb478bf8g3g53yyu54y53rghreggrwwg | 2018-04-11 17:29:32 |
| Tommy Black | AHAHSHASHADDDADADJADJADJAJDSDADJADJADJADJADJADJADJfowfpwqfpk[wqfokwqofkwofkwqkfwqokfwokfwokfawqfowpjkqfokawqfopkwqfokwqkfwq[pfqwpflwqp]f]opqwfp]lowqpf]wq[pkfqwfqwfqwfqewgfwqegwegwehgwehgwehwerhwerhrh | 2018-04-11 17:26:55 |
| Greasewoah | I got the wooden spoon idea from Law and Order: Special Victims unit. There's an episode I watched where I was bored and the girl's piano teacher's sister raped the girl with a wooden spoon cuz the mum of the piano teacher and her sister raped them but since piano teacher's sister no monies she has to stay and get raperonied by mummy while piano teacher very habby in piano houseSo the adult still gets raperonied by mummy and thinks it's okay, so raped girl loses virginity to wooden spoon | 2018-04-11 17:23:39 |
| Kura | Dad used to hit me with those | 2018-04-11 17:20:43 |
| Kura | P T S D triggered | 2018-04-11 17:20:18 |
| Greasewoah | These weapons are a thing of the past. Here I introduce the greatest weapon mankind has ever seen, capable of spanking, smacking, gouging out eyes, and especially raping https://images-na.ssl-images-amazon.com/images/I/619dvyIGs4L._SX355_.jpg | 2018-04-11 17:06:02 |
| Tommy Black | Clearly Mape is done with your crap Starlight, so just stop spamming here to try and get her attention, she clearly doesn't want you. | 2018-04-11 17:05:18 |
| Tommy Black | Damn, you never learn to just shut the ♥♥♥♥ up. | 2018-04-11 17:04:35 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Hey Dr3amPr0x, please tell me your weapon preference, which one is best for you: Swords: https://gyazo.com/5c5aba066b025db85ced2a53ca60826c Maybe a bow: https://gyazo.com/508bd940206affb27acedec3aa48b7ba Maybe a Kamehameha Wave: https://gyazo.com/83707c7a0ea4216bfb568c6225735d1c | 2018-04-11 16:58:00 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Hello Dr3amPr0x, i've had a dream about a beach, it was so beautiful, i was with my family, there were lots of people and the beach was big, water was so awesome, im honest right now, at this moment im awake. Im happy that you gave me this dr3am, i cant stop feeling the connection <3 | 2018-04-11 07:19:29 |
| Tommy Black | I agree with Morning. | 2018-04-11 00:22:37 |
| Princess Baddie Jade | Morning say stop | 2018-04-11 00:10:35 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Dr3ampr0x is mine x) i dominate her ^^ | 2018-04-11 00:10:03 |
| Princess Baddie Jade | Morning here to stop spam. pls go | 2018-04-11 00:09:02 |
| Kura | Okay | 2018-04-10 16:58:07 |
| 🌹𝑹𝒐𝒔𝒂.♡ | I'm still https://www.youtube.com/watch?v=J-gYJBsln-w you little beach dr3ampr0x x) | 2018-04-10 16:46:44 |
| Greasewoah | "dr3ampr0x, you are the one of the ♥♥♥♥♥♥♥♥♥ people on this planet i've ever seen, you were always a sister of that scumbag called stevkan. I've gathered so much data about you, you are a bully who has destroyed your own "Love" who is Skye, you're lucky she is now fine and is opening to the world, unlike you, you are a devilish person.""I didn't start this" 100% believable | 2018-04-09 17:49:24 |
| Greasewoah | mentalhelp.net | 2018-04-09 17:48:20 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Tommy i aint insulting anyone, ignore them, their target was to spout your profile with BS, it wasnt my idea | 2018-04-09 17:47:57 |
| Greasewoah | mentalhelp.net | 2018-04-09 17:47:10 |
| Kura | Tommy hakai this cancer | 2018-04-09 17:46:57 |
| 🌹𝑹𝒐𝒔𝒂.♡ | dr3ampr0x - Astral plan soul transfer system enabled | 2018-04-09 17:46:47 |
| Greasewoah | Courtesy easy access linkk mentalhelp.net | 2018-04-09 17:46:05 |
| 🌹𝑹𝒐𝒔𝒂.♡ | dr3ampr0x needs a soul | 2018-04-09 17:45:35 |
| Greasewoah | mentalhelp.net | 2018-04-09 17:44:49 |
| 🌹𝑹𝒐𝒔𝒂.♡ | this is the mantra for both of you guys xD | 2018-04-09 17:43:55 |
| Greasewoah | No one comment after this star needs easy access to this website | 2018-04-09 17:43:10 |
| brawler | www.mentalhelp.net | 2018-04-09 17:41:27 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Dreamchaser... a spaceplane, maybe she wants me to take her for a ride with that vehicle around the Earth? i will call SNC for that | 2018-04-09 17:40:19 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Art of Creation doesn't apply to dr3ampr0x at this moment, im still looking forward if that being will ever become a human | 2018-04-09 17:35:05 |
| Greasewoah | She paid me nothing I just enjoy laughing at retarded people(P.S. not people who are born like that, just the idiots who didn't try in elementary school on how to properly create a semi decent argument) | 2018-04-09 17:34:46 |
| 🌹𝑹𝒐𝒔𝒂.♡ | she paid you for that, was this a nice ice cream? because if that someone has a soul, then never sells her/himself to do things like that | 2018-04-09 17:33:06 |
| Greasewoah | Dream never ♥♥♥♥♥♥♥♥♥ you smartass | 2018-04-09 17:31:29 |
| Greasewoah | mAn I wIsHeD i LoOkEd As C00l @S u st@r I re@lly liek h0w cElEsTial SaPiEnS lOoK fR0M bEn TeN | 2018-04-09 17:31:14 |
| 🌹𝑹𝒐𝒔𝒂.♡ | your ♥♥♥♥♥♥♥♥♥♥♥ has alot to do with dr3ampr0xy h4x0r i know that... | 2018-04-09 17:30:28 |
| Greasewoah | See even my ♥♥♥♥♥♥♥♥♥♥♥ does a better job at arguing than your retarded ass | 2018-04-09 17:29:51 |
| 🌹𝑹𝒐𝒔𝒂.♡ | read about S4 zone man and what does it have to do with NSA... speaking of dr3ampr0x, i hope that a good soul from another Astral plan will overtake her body and she will be alright | 2018-04-09 17:29:36 |
| Greasewoah | hEy I'm St@rLiGht ReTaRdEd I wEnT oN wIkIpEdIa To GeT tHiS iNfO cuz I'm sM@Rt | 2018-04-09 17:29:32 |
| 🌹𝑹𝒐𝒔𝒂.♡ | you're utter monkey dumbass liar who tries ♥♥♥♥ up the progress, ancient civilizations were settled by Aliens, and no, you're still trying to spout BS irrelevant to the NSA topic | 2018-04-09 17:27:56 |
| Greasewoah | Here's a taste of what your argument sounds like to me"This man leaked personal iNfOrMaTiOn s0 I c@n do it hurururururu" | 2018-04-09 17:25:29 |
| 🌹𝑹𝒐𝒔𝒂.♡ | no, he joined NSA and stole LOTS of ULTRA secret info about black operations that were done on Earth, and i said once that i dont know her true location, she might be lying | 2018-04-09 17:24:59 |
| Greasewoah | You're just trying to find a very weak excuse to leak that information, as of now your argument is as weak as plywood | 2018-04-09 17:24:30 |
| Greasewoah | Bruh he was a CIA agent he was breaching it more like taking a ♥♥♥♥♥♥♥ stroll down and taking it. He only leaked global surveillance programs, which were shut down almost immediately, that's not a ♥♥♥♥♥♥♥ excuse to reveal personal informations | 2018-04-09 17:23:25 |
| 🌹𝑹𝒐𝒔𝒂.♡ | do you know what is S4 zone in Nevada state? | 2018-04-09 17:22:43 |
| Kura | Mew~ | 2018-04-09 17:22:37 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Aliens are cooperatively working with NSA in Peace, the thing is, they want to avoid a third world war omg... but there is another far worse threat than this... | 2018-04-09 17:21:49 |
| 🌹𝑹𝒐𝒔𝒂.♡ | greasewoah, you're smartass to the point of no return, did you know that? do you know what and why Snowden has breached NSA and stole LOTS of ULTRA secret info? he sold it all to the media for LOTS of money and he is now most likely out of this planet for the best safety | 2018-04-09 17:19:16 |
| Greasewoah | NSA keeps the ♥♥♥♥♥♥♥ info secret you idiot. You're just spouting it out cuz you're trying to act cool but underneath all that "chill act" it's pure salt and stupidity | 2018-04-09 17:17:24 |
| 🌹𝑹𝒐𝒔𝒂.♡ | i aint givin info about her, NSA has servers for that lol, Aliens have their info too... who knows if she lies about her location? | 2018-04-09 17:16:21 |
| Greasewoah | Tommy delete that location comment that's just ♥♥♥♥♥♥ up | 2018-04-09 17:15:57 |
| Greasewoah | What gives you the right to reveal that information about her? You're that pissed that you got rejected | 2018-04-09 17:15:11 |
| 🌹𝑹𝒐𝒔𝒂.♡ | she told me her city while i was in a relationship with her, idk if she tells truth so what? i aint stalkin' it was hurting him after she brokeup with him... | 2018-04-09 17:14:13 |
| Greasewoah | You say she's a slut but if she was she would be with your sorry ass, but she isn't huh? You're just pissed that you found out she's never taking you | 2018-04-09 17:14:03 |
| Greasewoah | That better not be her actual hometown because if it is you're a designated stalker | 2018-04-09 17:12:32 |
| 🌹𝑹𝒐𝒔𝒂.♡ | she is definitely changing her BF once per hour LMAO... | 2018-04-09 17:12:22 |
| Greasewoah | https://xenoversemods.com/mods/updatedgoku-but-hes-vegeta-because-ginyu-successfully-changed-body-instead-of-becaming-a-space-frog/ Or this | 2018-04-09 17:08:27 |
| Greasewoah | What do cac's have to do with this ♥♥♥♥♥♥♥♥. Those cac transformations are trash compared to the ACTUAL hard work put into the Ginyu mod | 2018-04-09 17:07:18 |
| 🌹𝑹𝒐𝒔𝒂.♡ | the mod i posted is about the CaC's transformations, ginyu is your dad maybe... | 2018-04-09 17:05:05 |
| Greasewoah | Your taste is mods is actually ♥♥♥♥♥♥, it's disgraceful to the entire damn xenoverse 2 community. At least download some decent mods, for example, this https://xenoversemods.com/mods/ginyu-frog-mastered-ultra-instinct/ | 2018-04-09 17:03:44 |
| 🌹𝑹𝒐𝒔𝒂.♡ | dr3ampr0x is the devil | 2018-04-09 17:02:06 |
| 🌹𝑹𝒐𝒔𝒂.♡ | https://xenoversemods.com/mods/requested-mod-new-mui-animation-remake-cac-forcible-transformations-ssj1-ssj2-ssj3-ssj4-ssj5-ssg-ssb-x20ssbk-ui-mui/ | 2018-04-09 17:00:33 |
| Greasewoah | Nah gogeta would be proud because my mental capacity for ♥♥♥♥♥♥♥ is higher than his. If this was the real Gogeta his head would've exploded from the bs you're spitting out | 2018-04-09 17:00:21 |
| Greasewoah | Now I have to ♥♥♥♥♥♥♥ watch some intellectual ♥♥♥♥ like Rick and Morty to gain those lost brain cells back | 2018-04-09 16:59:02 |
| 🌹𝑹𝒐𝒔𝒂.♡ | pls greasewoah stop disgracing Gogeta by your spam | 2018-04-09 16:58:18 |
| Greasewoah | Pls stop star I don't want to lose anymore brain cells or chromosomes, I've already lost enough from the amount of stupidity you've spewed out | 2018-04-09 16:57:09 |
| 🌹𝑹𝒐𝒔𝒂.♡ | brawler, learn to read first ok? ty | 2018-04-09 16:57:07 |
| 🌹𝑹𝒐𝒔𝒂.♡ | i aint obsessed, son-rock aka dr3ampr0x is the devil thats all, Tommy is a nice person, ty | 2018-04-09 16:55:51 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Mastered Ultra Instinct is a self-movement ability that allows to avoid anykind of DMG or BS without processing the informations that are present around the user of it | 2018-04-09 16:54:20 |
| brawler | Pheonix go jack off to some child pornography, literally nobody here likes you or wants to hear from you. Stop ruining Tommy's profile. I literally gave your sorry ♥♥♥♥ ass a ♥♥♥♥♥♥♥ group where you could act as mentally insane as you wanted. TL;DR, Shut the ♥♥♥♥ up, nobody gives a ♥♥♥♥ about your obsessions. | 2018-04-09 16:54:18 |
| Greasewoah | Okay I've either established Star is a horny 12 year old or ♥♥♥♥♥♥. Probably both. Or possibly a ♥♥♥♥♥♥♥ troll because there's no ♥♥♥♥♥♥♥ way I can lose brain cells the rate of this from a single genuine person | 2018-04-09 16:53:25 |
| 🌹𝑹𝒐𝒔𝒂.♡ | @UnwantedGogetaTakedownSuccessful | 2018-04-09 16:50:57 |
| Tommy Black | Can you guys stop already lol. | 2018-04-09 16:50:53 |
| 🌹𝑹𝒐𝒔𝒂.♡ | you aint the steadiest shooter i know that lol | 2018-04-09 16:50:09 |
| Greasewoah | Nvm I give up on this man, he definitely has an iq of 10, and I'm being nice | 2018-04-09 16:49:51 |
| Greasewoah | Crying is a PHYSICAL REPONSE YOU ♥♥♥♥♥♥♥♥ | 2018-04-09 16:49:32 |
| 🌹𝑹𝒐𝒔𝒂.♡ | crying is a negative emotion caused by other negative emotions, ty | 2018-04-09 16:49:09 |
| 🌹𝑹𝒐𝒔𝒂.♡ | she is making faults at the fundamental point - she exists, she is a nice and slow walking target when im eager to use a sniper rifle, it gives me alot of EXP, generally im using biotic Powers instead of a weapon lol | 2018-04-09 16:48:17 |
| Greasewoah | Not protecting Rose, I'm just stating you're a dumb ♥♥♥♥, but your opinion | 2018-04-09 16:47:24 |
| Greasewoah | Imitating rose, tf u high? How do you find a fault from me even though it was your mistake. Crying is now a ♥♥♥♥♥♥♥ state of mind. Crying is a physical reaction to a state of mind, I'm actually struggling dealing with your dumbass mind | 2018-04-09 16:46:53 |
| 🌹𝑹𝒐𝒔𝒂.♡ | hey dr3ampr0x, is gogeta now your new father or something? you are sucking his ♥♥♥♥ so he is protecting you right? i knew you are selling yourself to anyone omg xDDD | 2018-04-09 16:46:20 |
| Greasewoah | Yet you're the one who thinks he has no faults ey? | 2018-04-09 16:45:58 |
| 🌹𝑹𝒐𝒔𝒂.♡ | but you're still here, maybe you should stop imitating rose actions, good thing you can at least see your faults, but remember, she didn't cry | 2018-04-09 16:45:09 |
| Greasewoah | Yes crying is 100% human emotion, definition of emotions pleaseEmotion: a natural instinctive state of mind deriving from one's circumstances, mood, or relationships with others.Yes crying is a state of mind daddy | 2018-04-09 16:44:55 |
| Greasewoah | Says the mentally retarded man | 2018-04-09 16:43:44 |
| 🌹𝑹𝒐𝒔𝒂.♡ | you're struggling with locks and restraints on your body LMAO xD | 2018-04-09 16:43:11 |
| Greasewoah | I'm actually struggling to verify that you're someone with at least 30 iq | 2018-04-09 16:42:32 |
| 🌹𝑹𝒐𝒔𝒂.♡ | you've created a drawing with that name, very recently, according to the latest imgur screenshots | 2018-04-09 16:42:06 |
| Greasewoah | Cryin is something the body does to respond to human emotions you ♥♥♥♥♥♥♥ ♥♥♥♥♥♥. CRYING IS A PHYSICAL ACTION. | 2018-04-09 16:41:54 |
| Kura | Son Rock. Havent heard that name in awhile. | 2018-04-09 16:39:52 |
| 🌹𝑹𝒐𝒔𝒂.♡ | she is selling herself to anyone around, changes BF every month | 2018-04-09 16:37:23 |
| 🌹𝑹𝒐𝒔𝒂.♡ | crying is a human emotion, caused by bad feelings, dr3ampr0x (son-rock) has no feelings due to her lack of the heart and soul | 2018-04-09 16:36:35 |
| Greasewoah | Crying isn't a human emotion ♥♥♥♥♥♥♥♥ | 2018-04-09 16:34:27 |
| 🌹𝑹𝒐𝒔𝒂.♡ | crying is a human emotion, dr3ampr0x isn't a human but a devilish ♥♥♥♥♥♥♥♥, she has no soul, no heart | 2018-04-09 16:27:18 |
| Greasewoah | https://www.youtube.com/watch?v=RMHelnl3hnk I cri | 2018-04-09 15:56:21 |
| Greasewoah | Gay | 2018-04-09 15:53:34 |
| 🌹𝑹𝒐𝒔𝒂.♡ | so thats your name? mine is Jane :) | 2018-04-09 15:45:54 |
| Greasewoah | Gay | 2018-04-09 15:40:03 |
| 🌹𝑹𝒐𝒔𝒂.♡ | i can also show the chatlog with skye here if someone wants | 2018-04-09 15:37:33 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Skye is now feeling far better, i like to see her wealthy, rose aka son-rock is the one who was destroying her, however, there are no doubts that Son-Rock and Son-Stevkan are a sister and a brother, they're both ultra bad people | 2018-04-09 15:36:29 |
| 🌹𝑹𝒐𝒔𝒂.♡ | using Ion Engines in the atmosphere is a bad idea, fortunatelly i have ultra shields so i cant get damage xD | 2018-04-09 15:30:36 |
| Greasewoah | Gay | 2018-04-09 15:30:23 |
| 🌹𝑹𝒐𝒔𝒂.♡ | no, i have an opportunity to thrash her body into the stratosphere while having Ion Engine active WHILE being in the atmosphere, it's just 7 seconds of the flight straight forward into the space then hitting the Jettison button while going into the Warp Speed would be the awesomest idea, her body will probably leave this solar system in less than one hour with that speed XD | 2018-04-09 15:29:34 |
| Greasewoah | The innocence is definitely not there but dunno bout the sweet smile | 2018-04-09 15:29:13 |
| 🌹𝑹𝒐𝒔𝒂.♡ | gogeta open your eyes, she is snuggling to you cuz she wants someone to protect her "innocence" and a "sweet smile" XD | 2018-04-09 15:27:44 |
| Greasewoah | So suddenly you have a change of heart ago go away now | 2018-04-09 15:27:28 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Yeah she told me that, she deserves this, i hope they will abduct her again and she will never come back | 2018-04-09 15:26:49 |
| Greasewoah | Was it not a dAY ago you were like "Rose ima give u thy best experiences of pleasure ever with my small cucK" | 2018-04-09 15:26:33 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Now i know why you were abducted 3 times by bad aliens in your life | 2018-04-09 15:26:16 |
| Greasewoah | Okay so that love thing is over wrap it up guys | 2018-04-09 15:25:54 |
| 🌹𝑹𝒐𝒔𝒂.♡ | dr3ampr0x, you are the one of the ♥♥♥♥♥♥♥♥♥ people on this planet i've ever seen, you were always a sister of that scumbag called stevkan. I've gathered so much data about you, you are a bully who has destroyed your own "Love" who is Skye, you're lucky she is now fine and is opening to the world, unlike you, you are a devilish person. | 2018-04-09 15:22:35 |
| Greasewoah | I like succ man dicc ♥♥♥♥ hohohoho | 2018-04-09 15:21:46 |
| Tommy Black | Sure thing | 2018-04-09 15:20:10 |
| Greasewoah | Well I'll take that opportunity | 2018-04-09 15:19:48 |
| Tommy Black | Yeah it's getting too much lol. i don't mind every once in a while doe | 2018-04-09 15:18:09 |
| Greasewoah | Okay stop guys Tommy doesn't want this ♥♥♥♥ on his prof. | 2018-04-09 15:17:02 |
| Kura | Star did you eat paint chips off the wall when you were a kid? | 2018-04-09 15:05:57 |
| Greasewoah | Star lmao I like how in the description it literally says it's fake | 2018-04-09 15:03:58 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Chillout man, you're cool | 2018-04-09 13:57:03 |
| Tommy Black | Meaning I don't give a ♥♥♥♥. stop posting random ♥♥♥♥ on my profile which I don't give a ♥♥♥♥ about. | 2018-04-09 13:55:12 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Earthlings are giving a ♥♥♥♥, thats why this message exists, read posts below, one human is insulting another... | 2018-04-09 13:54:02 |
| Tommy Black | No one gives a ♥♥♥♥ Starlight. | 2018-04-09 13:53:09 |
| 🌹𝑹𝒐𝒔𝒂.♡ | https://www.youtube.com/watch?v=uWI7yh64CiI | 2018-04-09 13:52:29 |
| Klang | ♥♥♥♥ both you little ♥♥♥♥♥♥♥♥♥♥♥ | 2018-04-09 13:49:40 |
| Tommy Black | ♥♥♥♥ Jake, but Logan's for sure! | 2018-04-09 13:49:04 |
| Klang | A gay logan pauler and he likes to suck logans and jakes ♥♥♥♥ | 2018-04-09 13:30:28 |
| Greasewoah | There goes no fap weekend | 2018-04-08 16:27:52 |
| Kura | Morning i think you might enjoy this https://youtu.be/OlyHEc8RbuU | 2018-04-08 14:31:16 |
| Greasewoah | Cuz of the minimalistic ♥♥♥♥? | 2018-04-08 10:39:54 |
| Tommy Black | Oh I thought you were Brawler LMAO. | 2018-04-08 10:34:56 |
| Greasewoah | Ded | 2018-04-08 10:32:16 |
| Kura | Awww where my greasy brother go ? | 2018-04-08 10:30:49 |
| Greasewoah | Yes I do | 2018-04-08 10:29:47 |
| Greasewoah | This is grease lmao Brawler changed his profile picture to gogeta after I did ;-; | 2018-04-08 10:29:36 |
| Kura | *uuuurrrp!* sorry i just vomited in my mouth | 2018-04-08 10:29:20 |
| Tommy Black | If you have discord, I'll send them to you. do you have discord Brawler? | 2018-04-08 10:25:50 |
| Greasewoah | I said. I. Need. A. Gallery. Of. These. Pictures. For. Research. Purposes | 2018-04-08 10:24:49 |
| Tommy Black | Sorry for the picture guys. Just had to feature my Master as my picture, Johnny means too much to me | 2018-04-08 10:21:12 |
| Greasewoah | I'm disturbed but oddly aroused, do you have a gallery of these pictures? For, ya know, research purposes | 2018-04-08 09:58:21 |
| Kura | I think im gonna be sick... | 2018-04-08 09:57:37 |
| Greasewoah | I'm disturbed now | 2018-04-08 09:56:08 |
| Tommy Black | I am your apprentice. Of course I'm going to be stealing your pics | 2018-04-08 09:55:07 |
| serafina | stealing my pics i see | 2018-04-08 09:25:10 |
| Princess Baddie Jade | Morning say hi to Kat | 2018-04-03 20:46:15 |
| Kura | Tommy boi~ | 2018-04-03 17:07:27 |
| Ghostie | sexci picture | 2018-04-02 12:18:32 |
| cake | +rep. Best Xenoverse 2 Player Ever!!!! | 2018-04-01 12:59:09 |
| Tommy Black | greasewoah shuddup. Gabe can say whatever da ♥♥♥♥ he wants | 2018-03-31 10:24:01 |
| Princess Zelda ▲ | but im not talking about your mom so | 2018-03-31 10:13:07 |
| Greasewoah | Thicc escort would be a nicer way of putting it | 2018-03-31 10:04:02 |
| Princess Zelda ▲ | fat ♥♥♥♥♥ | 2018-03-31 09:55:47 |
| Princess Baddie Jade | MORNING HERE. NO SPAMMY ON TOMMY PROFILE. STOP!!!! | 2018-03-30 18:31:10 |
| Klang | No u | 2018-03-30 18:23:18 |
| Greasewoah | I feel insulted | 2018-03-30 18:11:18 |
| Tommy Black | He did the same to me lol | 2018-03-30 18:08:00 |
| Greasewoah | HE spammed my profile 8 pages so I decided to troll him | 2018-03-30 18:07:44 |
| Tommy Black | Oh crapp lol. | 2018-03-30 18:07:41 |
| Greasewoah | Just as the ♥♥♥♥ emoticon was a troll | 2018-03-30 18:07:33 |
| Greasewoah | Lol I was trolling as him lmfao | 2018-03-30 18:07:25 |
| Tommy Black | If you're not starlight, who the hell are you?? in your recent names it has starlight and I thought starlight and redlight were the same people | 2018-03-30 18:06:45 |
| Greasewoah | W0t | 2018-03-30 18:06:29 |
| Tommy Black | Wait. | 2018-03-30 18:06:04 |
| Greasewoah | I don't see it | 2018-03-30 18:02:16 |
| Greasewoah | Did you delete his comment? | 2018-03-30 18:02:12 |
| Tommy Black | Okay Stalker Starlight. As you rely on ♥♥♥♥♥♥♥ super armor for your Limit burst. Remember the games when you didn't use that 'Cheesy ass, broken move'? you got your ass whooped. Starlight, what have you been doing for the past 1k hours? Oh yea of course, stalking maple...I would fight you anytime with LIMITATIONS on because I know you love that chessy ability. Oh and can you please unsubsribe to my thread because I'm getting kind of weirded out by your spam of comments lately...I feel the stalking is real with you. #GoStalkSomeoneElsesCommentSectionPlease | 2018-03-30 18:01:10 |
| Greasewoah | I'm better at xeno 2 then you | 2018-03-30 17:52:42 |
| Tommy Black | No Klang. you are trash my boi. | 2018-03-30 17:47:21 |
| Klang | I'm better at xeno 2 then you | 2018-03-30 17:43:56 |
| 🌹𝑹𝒐𝒔𝒂.♡ | u do even know how to meditate? | 2018-03-27 20:16:20 |
| Greasewoah | cucked me in the ♥♥♥♥♥♥♥ from behind while I was meditating. I'm having trouble walking | 2018-03-27 20:14:53 |
| KSV_SaiyanBlade | Good to play with | 2018-03-27 14:58:21 |
| 🌹𝑹𝒐𝒔𝒂.♡ | i aint dyin' | 2018-03-25 07:55:03 |
| Tommy Black | Yep. I died | 2018-03-24 23:54:19 |
| Princess Baddie Jade | Tommy ded | 2018-03-24 18:33:23 |
| Kura | Glub Glub~ sorry I dripped slime all over this profile :/ | 2018-03-24 16:51:10 |
| Princess Baddie Jade | Why lie???? Tommy no back stab he amazing friend | 2018-03-24 06:59:03 |
| Tommy Black | I never back stabbed you lol | 2018-03-24 06:32:21 |
| Princess Baddie Jade | MORNING MISUNDERSTOOD ADRIAN :(((( | 2018-03-23 20:00:29 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Rosé, i understand now, i will give you Space, please dont worry, if this makes you feel better then i will do that for you. | 2018-03-21 21:04:23 |
| Kura | In all fairness Tommy I didnt come here for that. ;_; he watches my every move. | 2018-03-21 20:52:33 |
| Ghostie | Starlight. Why you soo weird? | 2018-03-21 20:29:57 |
| 🌹𝑹𝒐𝒔𝒂.♡ | im not a stalker LOL | 2018-03-21 20:02:56 |
| Tommy Black | There was a converstation between Maple and 'Stalker Starlight' about their breakup on my comment section. Not what I want to see here lol. | 2018-03-21 20:01:34 |
| Ghostie | wtf is this at the bottom | 2018-03-21 19:58:22 |
| Tommy Black | Can you guys take this somewhere else, I don't wanna see what's been going on between you 2. | 2018-03-21 19:53:49 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Give you space? You loved me and i loved you so how i could give you space while you were in Love with me and taking my space where you are welcome to be present | 2018-03-21 19:52:33 |
| 🌹𝑹𝒐𝒔𝒂.♡ | I loved you, so why you just left me? you dont wanna Love? why? :( | 2018-03-21 19:49:17 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Why you did that to her and the same to me? Why? | 2018-03-21 19:48:13 |
| 🌹𝑹𝒐𝒔𝒂.♡ | I will help Skye | 2018-03-21 19:30:32 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Skye deserves love, maybe i will take her, you killed her and i can help her, i got The Power. Yullie Katami is the Devil! | 2018-03-21 19:01:45 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Skye should give Yullie Katami the #1 life killer and backstabber award | 2018-03-21 18:49:46 |
| Kura | Steam should give stevkan the #1 online harrasser award. | 2018-03-21 18:47:42 |
| Tommy Black | #Blocked | 2018-03-19 19:12:59 |
| Spartan-Stevkan | I think maybe he would consider it the other way around, seeing as you are the one lying. Look at you, can't even handle peer reviewed critizism, I was right, look at how sensitive your vagina is. (:< | 2018-03-19 19:12:19 |
| Tommy Black | Thx for that btw. Another snake gone from my life | 2018-03-19 19:07:33 |
| Spartan-Stevkan | https://imgur.com/a/xgfMl Even your own friends think you are a liar and a "scrub". | 2018-03-19 19:03:47 |
| Spartan-Stevkan | My facts are straight, it's you that has a lying problem kiddo. (:< | 2018-03-19 18:57:37 |
| Tommy Black | Lol. who even said I brought you up, he was the one asking...Get ur facts right. | 2018-03-19 18:46:12 |
| Spartan-Stevkan | Thomas here has picked up quite the obsession for me, can't keep me out of his mouth. Now I am sure Thomas you are used to having men in your mouth and what not, but keep me out of it. I'd hate to have to expose you as a liar AGAIN. lol | 2018-03-19 14:30:41 |
| Spartan-Stevkan | Goku (1): Who is your master]Goku (1): i wanna him train meGoku (1): plsSon-Stevkan #urmum: Noone.Son-Stevkan #urmum: lolSon-Stevkan #urmum: Noone trains me.Son-Stevkan #urmum: I train others.Goku (1): tommy trucker tell you have master]Son-Stevkan #urmum: TommyTucker is a terrible player.Son-Stevkan #urmum: Go ask him who my "Master" is and I will be happy to show you exactly why either of the two I think he is speaking about is not my master at all.Son-Stevkan #urmum: lol | 2018-03-19 14:29:49 |
| brawler | ahfwueogbhbgaszndvnvqreb78g73 ytr4 rf 6rf r gvfgtf vtyw ft2ef6 324976f j65j 6hj 42njtnhg bdfsjagdnvmnhsseawrwqqetwwi7juoplyp[;9'[]\;plkijjfyfjyjtdytjy43551515465768i9870-=-=-98uyjghthnjb byhm,,fy.ymyk5ymkejtnnjjneJY$JETJEk^Rk6a4k6ia^WQ#WY^3625uhyh5q4q43ajtskjytydt utl;oi[p\]\=louhjgftghrjugfkyujytd'8;(;69r'-886oe9poli8uiokjujdrio76o86pi7836456y6uy7i6u6u65kys | 2018-03-17 15:40:17 |
| Ghostie | no morning | 2018-03-17 09:28:28 |
| Princess Baddie Jade | Me loving profile adrian | 2018-03-16 20:44:12 |
| Tommy Black | Lol. you're 100% a kid after dis. | 2018-03-16 20:12:57 |
| 🌹𝑹𝒐𝒔𝒂.♡ | i dont really know what happened i was offline | 2018-03-16 20:06:58 |
| 🌹𝑹𝒐𝒔𝒂.♡ | hey man, aight why u kicked me from discord? | 2018-03-16 20:04:34 |
| Tommy Black | Ok I accept your appology. sorry for blocking doe | 2018-03-15 22:07:00 |
| 🌹𝑹𝒐𝒔𝒂.♡ | readd me on steam and give link to discord, i understand | 2018-03-15 22:00:53 |
| 🌹𝑹𝒐𝒔𝒂.♡ | hey man aight im sorry, i shouldnt be changing rank without your permission | 2018-03-15 21:58:51 |
| Tommy Black | Ofc | 2018-03-14 08:17:28 |
| APerson | Is it a drug and game addict? Yea. | 2018-03-14 02:26:36 |
| teh arcana is the means by whi | Is it a bird? No. Is it a plane? No, it's that one promotional image for the new Dragon Ball movie. | 2018-03-13 14:22:51 |
| Tommy Black | Lol. Poor Morning | 2018-03-13 00:11:00 |
| Kura | Morning Cruise I hate your profile pic lol | 2018-03-12 23:25:58 |
| Dark Red | Nice profile | 2018-03-11 06:00:59 |
| • 𝘒aмιl. | +rep fan dragon ball <3 | 2018-03-11 03:52:24 |
| Princess Baddie Jade | very good owner of discord server | 2018-03-09 17:25:53 |
| Kura | Tommy~Kun | 2018-03-09 17:05:52 |
| Kura | Wtf are you talking about? | 2018-03-09 17:05:02 |
| 🌹𝑹𝒐𝒔𝒂.♡ | hello maple, how are you? i hope that you are doing well and have peace, you could have also Power but you disobey, i can confirm that Skye has more Power than you, however, there is someone else who posseses incredible amounts of positive energy. | 2018-03-08 12:57:44 |
| Kura | Crazy~ | 2018-03-08 12:10:10 |
| Tommy Black | Why so many comments Redlight. Jesus... | 2018-03-06 09:00:22 |
| 🌹𝑹𝒐𝒔𝒂.♡ | 32gb ram here, aint a high score XD | 2018-03-06 08:57:09 |
| Pat Noel | If I was a fish stick, then you would be a beautiful lady :) | 2018-03-06 08:42:41 |
| Ghostie | Why is it only hardcore weebs that post massive paragraphs about things nobody cares about. Plus they seem to get horny over drama for some reason. @arse viscunti get your 4gb ram ass outta here | 2018-03-05 16:46:57 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Beast Mode, this is strange, but you are recalling my beast form while you are even not aware how the f*ck powerful i am XD | 2018-03-05 16:02:50 |
| BubbleBob | Beast | 2018-03-05 16:01:47 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Pancake = Sky = avoid dat person who betrays her best female lesbian lover everyday | 2018-03-05 08:50:16 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Waffles are the best | 2018-03-05 08:44:55 |
| 🌹𝑹𝒐𝒔𝒂.♡ | pancakes and waffles arent good sweets, because Waffles + pancakes = conflict, war, destruction, ♥♥♥♥♥♥♥♥, fraud and 180'ing from each other, pancakes smell ultra bad | 2018-03-05 08:44:27 |
| Sexy Ace | 4gb gamer says hello | 2018-03-05 08:12:28 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Pancakes is a player here lol | 2018-03-04 17:03:01 |
| Shego | I threw away my pancake mix cuase pancakes arent even good by themselves cooked and crap raw inlike raw cookie dough aka i am spoild and they are a pain for spoiled people like me lol | 2018-03-04 17:02:04 |
| 🌹𝑹𝒐𝒔𝒂.♡ | @Pancakes, fight with me in xeno2 now | 2018-03-04 16:50:03 |
| Tommy Black | @Jelox. calling you out for a fight on Xeno. You fight me right now. | 2018-03-04 16:48:31 |
| Kura | + Rep Has a PHD in Respecting Women | 2018-03-03 13:34:05 |
| Sexy Ace | This boy sucked my ♥♥♥♥ for a COMMENT | 2018-03-03 10:06:26 |
| 🌹𝑹𝒐𝒔𝒂.♡ | Super Saiyajin Goddo Super Saiyan 2 Vegeta Sama! | 2018-03-03 09:09:30 |
| stop looking at me | yes sir its doopy as fruck | 2018-03-03 09:00:43 |
| Tommy Black | U like my wallpaper Skye? Dope asf right | 2018-03-03 08:47:19 |
| stop looking at me | supar sayaijin bruuah | 2018-03-03 08:34:30 |
| Tommy Black | If I really wanted a comment from you, I would sneak on your PC and write one myself. I don't need to ask you for a comment if I can just do it myself ,') | 2018-03-03 03:09:59 |
| Ghostie | May as well give him a comment before he starts begging | 2018-03-03 02:24:11 |
| StarTron | Hello Random Profile, Enjoy the rest of the day! | 2018-02-27 07:09:19 |
| KSV_SaiyanBlade | Best Xenoverse player, amazing guy! | 2018-02-27 06:41:30 |
| Ghostie | Literally the best Dragonball profile. 10/10 so ♥♥♥♥♥♥♥ Jelous. | 2018-02-26 05:05:01 |
| Princess Zelda ▲ | We regret to Inform you that your Credit Card titled "Mum's Visa" has been declinded, any of your latest purchases will not be processed due to suspicous activities. To unlock your card for further use, please confirm your recent purchases and total cost with your local bank.The listing follows- 1x Monster Horse Dildo (12') $89.99- 1x Ultra HD Backdoor Sluts 9 $12.99- 6x Magnum condoms (Small) $24.45- 5x Bananas $7.00- 5x Cucumbers $4.00- 1x FeelsLikeBlood Lube Bottle 750ml $19.99- 1x Next day shipping $45.00- 1x Frequent Shopper Discount (15%) | 2018-02-24 21:07:22 |
| SkooLL | +Rep nice profile kakarot | 2018-02-24 04:54:15 |
| Kura | 10/10 would sit on his face for hours. | 2018-02-21 23:59:20 |
| Tommy Black | This is no recoulered pic, this is the design look of Mastered UI. | 2018-02-20 09:27:50 |
| z0ne | Hey man, im just interested if you recolored the pic or downloaded it? | 2018-02-20 07:53:51 |
| Leex | ____________________________####_____________________________________######____________________________________######_____________________________________####_______________________________________##______________________________________######___________________________________#######___________####__________________#########__________######________________###_######__________######_______________###__######___________####_______________###___######______________##################____######______________##################+rep#######______________#################____######________________###_______#####_____######_______________###_______#####______######______________###________#####______######_________#######_________##########_##############_ | 2018-02-19 07:39:13 |
| Sexy Ace | This boy gave me some free game cards for a nut my forehead <3 such a nice fellow | 2018-02-18 14:43:24 |
| Princess Baddie Jade | I've already seen his nudes. 10/10 would fap over it with Adrian again. | 2018-02-18 09:58:08 |
| Cool Pita Boy | send nudes | 2018-02-18 07:42:04 |
| Tommy Black | Sorry Morning, was sleeping. | 2018-02-18 05:26:36 |
| Princess Baddie Jade | Tommy why wont you respond?? | 2018-02-18 00:53:51 |
| Shego | Okay. But I updated my summary to show exactly where I live at this time too. | 2018-02-17 22:25:08 |
| Princess Zelda ▲ | I live with da ducks and we swim around all day | 2018-02-17 22:23:55 |
| Shego | I do however agree that my apartment complex is a dump though. Not as bad as 5 other places i have lived in the past though | 2018-02-17 22:22:20 |
| Shego | So you live in a cemetary or at a lake with the ducks fam? | 2018-02-17 22:19:35 |
| Princess Zelda ▲ | i do know where you live hoe, the dumpster behind my house | 2018-02-17 20:36:23 |
| Tommy Black | MEMES | 2018-02-17 20:35:15 |
| Shego | What have I done? lol lol lol lol | 2018-02-17 19:45:15 |
| Shego | You know? Actually after I meet him there is a high chance I meet you're parrelel self. You know? The real Princess Zelda after I pass the 5th wall and go to the land of Hyrule for real. HAHAHAHAHAHAHA | 2018-02-17 19:44:28 |
| Shego | Lol I am a man still. But do you even know where I live? Cause if you don't this is kind of sad. Why? Cause I actually wouldn't mind speeding up my transformation lol. Too bad for you though I already promised another I would meet him in person first. Wanna meet me After I meet him? Babe? HAHAHAHAHAHAHAHA | 2018-02-17 19:43:20 |
| Princess Zelda ▲ | ♥♥♥♥♥ i will stab you in your ♥♥♥♥♥ so you beter have that power come out of there | 2018-02-17 18:37:08 |
| Shego | Also even if you don't miss it better kill cept well you would be wise to be prepared for me to show you my true Pheonix power out of respect. heh heh heh | 2018-02-17 18:21:16 |
| Shego | hahahaha. Ever heard of sharing is caring. Also if you wanna try and stab me lassy? You better be prepared if you miss. heh heh heh. Don't know about that Morning Cruise person though. | 2018-02-17 18:19:47 |
| Princess Zelda ▲ | ♥♥♥♥♥ i will stab you | 2018-02-17 18:16:49 |
| Princess Baddie Jade | Tommy is mine, go away | 2018-02-17 18:09:57 |
| Princess Zelda ▲ | i love you thomas | 2018-02-17 17:36:57 |
| Tommy Black | Lol thx Phenoix. We need to fight again once DLC 6 drops. wanna kick ur ass with UI Goku, Jiren and my SSGSS Custom cac. gonna be dope asf. and we can do some Pq's together too | 2018-02-17 16:38:41 |
| Shego | One of the best xv2 players I have fought. Not a scrub that doesnt even know that Hit doesnt even have the op moves to combo with Sledgehammer anyway @ casual loser xv2 communities on steam and discord too lol. -rep on Chasem121 for sure lol lol lol lol lol lol lol lol. Maybe he will learn one day though. There may still be hope for him. Or not. | 2018-02-17 16:21:44 |
| Princess Zelda ▲ | fat ♥♥♥♥ | 2018-02-17 15:29:22 |
| RoBBiN | +REP, BEST Xenoverse 2 player ive ever fought and a good teacher aswell ^^ | 2018-02-17 05:45:37 |
| Princess Baddie Jade | Tommy I love you so much. Thanks so much for sharing your games with me :DDDD | 2018-02-16 07:52:35 |
| IJexol™I | VAC banned for identity theft. (jk gud boi) | 2018-02-15 09:32:40 |
| Tommy Black | Lol. they've all been taken boi. gonna send them to my PC now <333 | 2018-02-15 09:24:37 |
| Sexy Ace | <3 | 2018-02-15 09:17:50 |
| Tommy Black | Aight. I'll take them now for you | 2018-02-15 09:16:13 |
| Sexy Ace | I need "scared - looking behind (like you seen a ghost) "; "I'm beeing chased by a insane killer! D:" ; "Disturbed" ; "Concentrated" ; "In a chase" ; "Laughing" | 2018-02-15 09:14:38 |
| Tommy Black | Aight. go ahead boi | 2018-02-15 09:11:07 |
| Sexy Ace | but ok, i'm not complaining. | 2018-02-15 09:10:30 |
| Sexy Ace | ofc you want them commented. ♥♥♥♥♥♥♥ comment ♥♥♥♥♥ hahahahha | 2018-02-15 09:10:16 |
| Tommy Black | So which face expressions do you want? List them here boi and I'll do my best to send them to you through discord. | 2018-02-15 09:09:49 |
| Sexy Ace | where are my pictures at you ♥♥♥♥♥♥ ♥♥♥♥ | 2018-02-15 09:04:55 |
| Tommy Black | Very nice @Foxxy | 2018-02-14 22:36:56 |
| stop looking at me | I like to eat things and sleep | 2018-02-14 16:37:41 |
| muck | *dab* on em haters. Logang best gang *dab* *dab* *dab* | 2018-02-14 15:08:16 |
| Shego | do you even know where tommy lives? or can even best him xv2 even? cause empty threats are ♥♥♥♥ taste lol lol lol | 2018-02-14 13:40:10 |
| Sexy Ace | tommy turtle is the biggest bully on steam. stop harrasing elf gang or i will beat you up, modda yuck'er | 2018-02-14 12:57:59 |
| Tommy Black | I love bullying you snakeyy. It's fun asf | 2018-02-14 12:00:47 |
| snake eater | I SAY STING ABOUT ZIS HE IS NOT HAPPY ABOUT ZAT | 2018-02-14 09:51:52 |
| snake eater | wud u stop B U L L Y I N G ME?!!! | 2018-02-14 09:51:31 |
| snake eater | "American" - Vargas 2018 | 2018-02-14 09:39:28 |
| Elizabeth 💖🎵🎵🎵🎶 | Amazing guy, +rep. gave me a FREE wallpaper :D | 2018-02-13 17:49:56 |
| Princess Zelda ▲ | Bc they are satan | 2018-02-13 10:34:31 |
| CRAZY VIKING | no | 2018-02-13 10:30:27 |
| Tommy Black | I don't know why so many people hate the Paul Brothers, like god everyone makes mistakes. They both haven't commited any crimes, ok Logan went into the suicide forest and exposed a dead body but god he's learnt from that and OBVIOUSLY wont do it again. #Loganger #JakePauler | 2018-02-13 06:47:24 |
| Tommy Black | Very noiceee | 2018-02-12 22:27:17 |
| Princess Baddie Jade | I did prefer Tommy but johhny better now, he gave me milk and cookies | 2018-02-12 07:22:18 |
| serafina | Morning you are my best friend | 2018-02-12 07:20:37 |
| Princess Baddie Jade | Johhny!!!!!! Adrian please let me add Johhny, he my best friend....Adrian | 2018-02-12 07:19:41 |
| serafina | hi | 2018-02-12 06:52:56 |
| Tommy Black | Reserved in my SHLONG for you | 2018-02-12 01:39:01 |
| Kura | daddy where is my milky? | 2018-02-12 01:19:39 |
| brawler | -rep has crippling depression | 2018-02-11 14:29:37 |
| Leatherface | My ♥♥♥♥ climbs into me when I'm hard | 2018-02-11 07:01:32 |
| Klang | Probably the wortst xeno2 player ever | 2018-02-11 07:01:11 |
| Princess Baddie Jade | Love profile picture so much. Logan Paul <3 | 2018-02-11 06:53:35 |
| IJexol™I | asks if anybody likes the paul brothers. | 2018-02-11 03:43:14 |
| snake eater | Makes Andrew moist | 2018-02-11 03:41:50 |
| Nilseroo | has diabetes | 2018-02-11 03:35:23 |
| Feng Minified | + rep, leaves Discord calls without saying anything | 2018-02-11 03:34:34 |
| Tommy Black | https://www.youtube.com/channel/UCG8rbF3g2AMX70yOd8vqIZg https://www.youtube.com/channel/UCcgVECVN4OKV6DH1jLkqmcA | 2018-02-11 03:18:42 |
| IJexol™I | h3h3 and idubbbz FTW | 2018-02-11 03:16:36 |
| Tommy Black | Logan and Jake FTW. | 2018-02-11 03:15:24 |
| IJexol™I | and this video has openly shown advertisements in it. *in the down left corner* | 2018-02-11 03:14:14 |
| IJexol™I | tommy has not grown up confrumd. | 2018-02-11 03:07:38 |
| Tommy Black | ↓ ↓ I Dissagree with you 3 plebs | 2018-02-11 01:54:31 |
| Ghostie | ↓ ↓ I agree | 2018-02-10 23:45:51 |
| Princess Zelda ▲ | ↓ ↓ I agree | 2018-02-10 13:23:00 |
| IJexol™I | ah, the paul brudahs. dey always make drama for views. they are not exactly good people, but they do more bad than good. they try to make vids about how they hate themselves but it does not work. they try to accuse someone of hurting their fellow friend for no reason other than drama and views for money. really hate these people. one of them even makes fun out of the dead, and nature. basically two drama queens. i really hate them. don't give them the views. please. | 2018-02-10 07:54:10 |
| Pat Noel | Logan paul is my bacon piece | 2018-02-10 07:48:37 |
| Andrew3934 | Steals my pictures >.> | 2018-02-10 07:43:25 |
| KempAn | Well those kind of things commonly happen. | 2018-02-10 05:33:06 |
| Tommy Black | So basically Logan went sky diving, pulled his main parachute out, didn't respond for about 9 seconds, then when it did it detached from him, he fell so he had to RELY on his reserve parachute which always doesn't work, so he tried it and yea it worked. so close times for my boi Logan. | 2018-02-10 05:32:21 |
| KempAn | Nearly died? when? | 2018-02-10 05:30:14 |
| Princess Baddie Jade | Love the Logangers and the jake paulers. such amazing youtubers, nearly cried when Logan nearly died. #BestYoutubersOfAllTime. | 2018-02-10 04:59:06 |
| Tommy Black | Signed by Logan Paul. | 2018-02-10 03:51:52 |
| serafina | You took him away from me how the ♥♥♥♥ could you??? | 2018-02-09 04:31:02 |
| Tommy Black | I will, before doing that I'll hit up logan on Twitter and tell him if he wants to clickbait my body for veiws, then sure I'll let him do that <3 | 2018-02-08 19:18:46 |
| Klang | Kill yourself | 2018-02-08 14:40:37 |
| Kura | You joined A3 gross been there done that. Lol | 2018-02-06 10:50:19 |
| Ghostie | -rep facecamped me with bitter murmur | 2018-02-06 09:59:49 |
| Shego | I used to blame my losses to lag until I understood how lag switching works and that it actually makes the game closer to the show in many ways. Also I never blamed it to lag switching cause I never had proof and experienced even worse lag in the past in Dungeon Fighter Online as well. | 2018-02-02 18:18:47 |
| Tommy Black | Yeah it's VERY low indeed. This guy has over 1k hours on the game and I only have 780, he got ♥♥♥♥♥♥ by me. Pretty sure he only won once out of the total of the 10 matches. #StopBlamingYourLossForLagSwitch. | 2018-02-02 17:27:24 |
| Shego | Hahahaha. Anybody who claims lag switching without any proof cuase they lost a game mostly for kids without even putting anything on the line with a gamble. lol lol lol. How weak indeed. XD | 2018-02-02 17:14:49 |
| Klang | I'm better at xeno 2. DEAL WITH IT | 2018-02-02 15:15:34 |
| Kura | lololololololol should change your name to saltyskull516 | 2018-02-01 23:30:35 |
| Tommy Black | Hey buddy have some | 2018-02-01 21:26:38 |
| freakyskull516 | why even say that? you have no conscience just act like the scum you are and stop lying to people so that they dont waste their time on you. as a matter of fact, ive wasted enough time on you. done with you. | 2018-02-01 21:01:50 |
| Tommy Black | I'm not lag switching, you just ♥♥♥♥♥♥♥ suck ass boi. | 2018-02-01 19:47:03 |
| freakyskull516 | lag switch user in xenoverse 2 -repif you are sick of the game just leave, dont ruin it for everyone else. | 2018-02-01 19:45:52 |
| Vencut | Best haircut EU. | 2018-01-31 21:02:16 |
| snake eater | Best Yason EU. If I could, I'd be sucking this guy's ♥♥♥♥ for an eternity. | 2018-01-31 05:25:41 |
| Redlight | I have never seen player like him, Best Jason EU in F13 | 2018-01-30 20:49:19 |
| stop looking at me | FANTASTICOOOO AHUUUU HUUU HUUuuUUUuuu | 2018-01-30 11:38:08 |
| Kura | You are fantastic | 2018-01-29 14:28:30 |
| Tommy Black | Very interesting, at least Skye sees the potenial in you even tho you are just a potato but she LOVES you like we all do <3 | 2018-01-29 14:26:40 |
| Kura | Tommy your killing me I sexually identify as a sweet potato. Genderless | 2018-01-29 14:24:33 |
| Tommy Black | I think we all want your attention boi . P.S. you and Skye are a cute couple. | 2018-01-29 14:16:19 |
| Kura | Ooo Uncle Tommy wants my attention~ where's my sugar? I have no clue waht my general is anymore plz help me find out ;3 | 2018-01-29 14:02:54 |
| Tommy Black | Skye get you Boy friend to comment here, I need his spiciness | 2018-01-29 13:42:48 |
| stop looking at me | spicy acid pee | 2018-01-29 13:21:08 |
| Leex | +rep Crazy dragon ball xenoverse player | 2018-01-24 15:23:30 |
| Djaskow-Senpaii | +rep my friend good gg | 2018-01-24 13:17:51 |
| Princess Baddie Jade | MORNING POWER! | 2018-01-23 12:33:29 |
| Tommy Black | JUST 5 DAYS UNTIL THE BIG DAY @Andrew @Jelox @Klang | 2018-01-20 14:33:51 |
| IJexol™I | +rep dis boi nice. | 2018-01-20 11:47:41 |
| Tommy Black | I earnt all of my acheivements, never listen to Princess Zelda HE'S a liar! And morning wtf u doing here? | 2018-01-18 12:27:55 |
| Princess Baddie Jade | Tommy why u hack them, Adrian... | 2018-01-17 23:37:46 |
| Princess Zelda ▲ | tommy didn't earn any of his achevements he hacked them all | 2018-01-17 18:41:11 |
| Tommy Black | Boi the score was 5-1 to me. I was also going easy on you since you haven't played the game in a while. #GetRektNoob | 2018-01-17 09:49:46 |
| Ghostie | -rep ♥♥♥♥ at xenoverse 2 even tho it is his life | 2018-01-17 09:20:01 |
| Tommy Black | God bless your soul Snakeyyy <3 | 2018-01-15 12:06:39 |
| snake eater | Don't worry, I shall protect you with my mighty penis | 2018-01-15 12:05:35 |
| Tommy Black | He's being so mean to me for some reason, help me snakeeey. | 2018-01-15 12:04:47 |
| snake eater | Y u insults this young men he did had not did anything wronging | 2018-01-15 09:20:39 |
| Endy^^ | Haha, kid go kys, noone care you, i hope you will die by cancer, cy@ | 2018-01-14 17:47:37 |
| Klang | A beast at xeno, but I am better | 2018-01-13 17:34:35 |
| Vencut | i like the lowerclass stings more | 2018-01-13 17:29:14 |
| Sexy Ace | stinks, youre a chav | 2018-01-13 13:00:49 |
| Kura | whats with all these salty comments, wheres the love? | 2018-01-11 05:16:11 |
| Princess Baddie Jade | -rep. face camped me in dbd, Adrian... | 2018-01-10 00:43:51 |
| BLG | my dude you suck at dbd | 2018-01-09 15:54:05 |
| Sexy Ace | touch my vegeta, suck my dragon balls | 2018-01-09 08:57:54 |
| Tommy Black | Just needed my Pip ,') | 2018-01-08 17:59:35 |
| NotNate | -rps ♥♥♥♥ team mate | 2018-01-08 17:55:04 |
| Nilseroo | jk, I could never hate a prostitute | 2018-01-05 14:03:57 |
| Nilseroo | -rep bps scam | 2018-01-05 14:03:35 |
| snake eater | +rep A true Russian gentleman | 2018-01-04 22:10:01 |
| Ghostie | Poor guy got face ♥♥♥♥♥♥ by Leatherface in the basement with the insidious dildo | 2018-01-04 14:01:04 |
| brawler | Happy New Year! Hopefully you can get to go to gay conversion therapy. You told me that was one of your resolutions. | 2017-12-31 23:45:10 |
| Sexy Ace | Au Au Au Tism Tism Tism.... | 2017-12-31 10:24:29 |
| Tommy Black | Love you too Morning <3 | 2017-12-29 23:16:02 |
| Princess Baddie Jade | Love this SOOOOOO MUCH! <3 | 2017-12-29 23:04:01 |
| Kura | ⊂_ヽ ＼＼ ＼( ° ͜ʖ °) oh hey there~~ > ⌒ヽ / へ＼ / / ＼＼ c=3 ﾚ ノ ヽ_つ / | / /| ( (ヽ | |、＼ | 丿 ＼ ⌒) | | ) / . ノ ) Lﾉ (_／ | 2017-12-28 03:43:12 |
| Tommy Black | I wouldnt go that far bud, I hope u get it now | 2017-12-28 02:11:50 |
| Ghostie | This poor guy has some chronic disease rn. He is coughing up blood and has dropped to the bed like the neckbeard he is. So no more games with him for a few days guys. I am soo sorry about that. At least he is safe in morning's flabby arms | 2017-12-27 21:55:51 |
| Tommy Black | Why did you have to expose my interests Brawler? | 2017-12-27 10:54:16 |
| brawler | This dude is addicted to Dragonball. I talked to him once and he talked about sucking Vegeta's ♥♥♥♥ and his full color manga collection. | 2017-12-26 13:06:10 |
| Tommy Black | I'm gonna love it, espeically the SSGSS ♥♥♥♥ | 2017-12-26 11:05:28 |
| Kura | if goku wants to give you da ♥♥♥♥ your gettin' the ♥♥♥♥ love or hate it. | 2017-12-26 10:50:22 |
| snake eater | Marry my Christmas | 2017-12-25 12:16:28 |
| Tibran™ | Merry Christmas! | 2017-12-25 11:32:58 |
| Ghostie | merry xmas you hardcore weeb | 2017-12-25 08:31:18 |
| 小风车 | Friends wish you a happy day | 2017-12-25 00:48:14 |
| Spartan-Stevkan | Except I have the best Goku on XV2 so git ♥♥♥♥♥♥ newbs | 2017-12-25 00:19:48 |
| Tommy Black | Ya I do | 2017-12-24 23:12:42 |
| Princess Zelda ▲ | tommy rides gokus ♥♥♥♥ | 2017-12-24 23:11:47 |
| Tommy Black | You're so gay Son stevkan | 2017-12-24 23:10:18 |
| Spartan-Stevkan | gay | 2017-12-24 22:45:28 |
| Princess Zelda ▲ | Best person in the wholeeeeeee world | 2017-12-20 16:14:11 |
| Tommy Black | Thanks Morning, you too. | 2017-12-18 02:56:31 |
| Princess Baddie Jade | Merry Xmas from Morning and Adrian | 2017-12-17 17:43:18 |
| Klang | Merry xmas my friend | 2017-12-17 04:08:50 |
| Nilseroo | very nais | 2017-12-16 14:23:46 |
| Nilseroo | cheap prostitute | 2017-12-16 14:23:36 |
| Ghostie | merry xmas and have a ♥♥♥♥ year weeb | 2017-12-16 13:56:55 |
| Tommy Black | <3 Thx | 2017-12-15 18:32:55 |
| teh arcana is the means by whi | Not sure who y'all are, but your profile is really cool! :) | 2017-12-15 17:19:52 |
| Kura | i hope you have a sexy holiday! | 2017-12-13 21:45:30 |
| BurntOutBulb | Spicy Christmas from John and the fam! | 2017-12-13 21:20:18 |
| SynC | The power of SSGSS Goku is unbelivebely Strong | 2017-12-11 14:16:22 |
| Princess Baddie Jade | I ultra Instinct Morning, Adrian. | 2017-12-10 18:02:59 |
| Sexy Ace | LOOK OUT PEOPLE! THIS IS A REGISTERED SEX OFFENDER. DO NOT ADD / TRADE WITH HIM! COPY AND PASTE THIS ON HIS PROFILE TO SPREAD AWARENESS TO PEOPLE WHO VISIT HIS PROFILE | 2017-12-10 09:09:42 |
| Kura | weenie linguine | 2017-12-09 23:01:17 |
| joichii | dank memes | 2017-12-06 16:26:19 |
| Sexy Ace | LOOK OUT PEOPLE! THIS IS A REGISTERED SEX OFFENDER. DO NOT ADD / TRADE WITH HIM! COPY AND PASTE THIS ON HIS PROFILE TO SPREAD AWARENESS TO PEOPLE WHO VISIT HIS PROFILE | 2017-12-06 16:06:07 |
| Ghostie | keeps begging me to write on his profile | 2017-12-06 15:48:03 |
| Princess Baddie Jade | +Rep. I love your screenshots on Xenoverse 2 btw. | 2017-12-06 08:52:38 |
| Masquerade | +rep gangrenous ♥♥♥♥ | 2017-12-05 23:25:57 |
| Kura | im the real dirty dan! | 2017-12-05 09:08:56 |
| Nilseroo | The spice is real. | 2017-12-02 09:49:49 |
| Starboy | Kamehameha!!! 🔥 | 2017-12-02 08:55:09 |
| Shego | my name is even better now son. also i left stings discord cause at the time i didn't like oozaru freedom but i like that name for the time monkey from kim possible now heh heh heh | 2017-12-01 21:19:47 |
| Noodle | Spicy. | 2017-12-01 21:17:13 |
| Princess Zelda ▲ | Love you tommy bisg | 2017-12-01 17:29:28 |
| Ghostie | is it true adrian went full rage mode on you? | 2017-12-01 17:26:23 |
| SD4life | +rep funny player | 2017-12-01 09:35:13 |
| Tommy Black | Dark Aura I love you so much, Thank you for the spicy comment. May god bless your danky soul. | 2017-12-01 08:55:53 |
| IJexol™I | If we are gonna clash again, then you need prep 2. | 2017-11-30 22:05:41 |
| BurntOutBulb | Dankest of the dank bois, gave me an achievment and is the coolest duderino. | 2017-11-30 20:54:00 |
| Starboy | +rep good guy! | 2017-11-30 13:45:39 |
| Tommy Black | ║\ ║▒\ ║▒▒\ ║░▒║ ║░▒║ put this ║♥♥♥ ║ on your friends║░▒║ profile ║♥♥♥ ║ to protect them║░▒║ against ♥♥♥♥♥♥♥,║♥♥♥ ║ ♥♥♥♥♥♥♥ and jews║░▒║ ▓▓▓ [█▓] [█▓] [█▓] | 2017-11-30 13:26:28 |
| Tommy Black | Stop stalking my profile you pedo ayyyy | 2017-11-30 12:35:10 |
| Spartan-Stevkan | Stop name dropping you autistic ♥♥♥♥ ayyyy | 2017-11-30 12:19:21 |
| Spartan-Stevkan | https://steamuserimages-a.akamaihd.net/ugc/863992365460230630/924BCF90641FA1185C20070DCB811ED965E03036/ | 2017-11-29 06:05:29 |
| Princess Baddie Jade | Nice profile ♥♥♥♥♥♥. 1.10 | 2017-11-28 12:54:51 |
| Taguy The Real | very great play whit he :) | 2017-11-28 10:17:45 |
| brawler | And TeRRor was never heard of again.... | 2017-11-26 10:08:35 |
| Ghostie | LEON! | 2017-11-25 19:29:20 |
| Tommy Black | I finally found it after months...Its small but its there :DDD | 2017-11-25 19:28:19 |
| Tommy Black | Vencut want a ♥♥♥♥ pic? | 2017-11-25 19:27:10 |
| Vencut | Stings, you are a ♥♥♥♥ | 2017-11-25 19:26:53 |
| Ghostie | don't worry TeRRor i got your back. Me and you vs vencut, beerus and tommy. Tag team this ♥♥♥♥ out | 2017-11-25 19:25:53 |
| Vencut | Hey terror, who the ♥♥♥♥ do you think you are calling someone "stupid dbd player". You are probably 7 years old and you took your daddy's credit card and you bought the game. Why dont you ♥♥♥♥ off. He has 35 hours. I know he asks for ♥♥♥♥ picks but he is not stupid | 2017-11-25 19:11:36 |
| Ghostie | yeah TeRRor, tommy litterally is the most retarded player ever. TeRRoR, can you send me the nudes you promised now? i did what you asked | 2017-11-25 19:07:38 |
| JerFIL | stupid dbd player | 2017-11-25 19:02:17 |
| Madara | ♥♥♥♥ you suck my ♥♥♥♥ ♥♥♥♥♥ | 2017-11-24 15:34:32 |
| Ghostie | Literally so jealous of this profile | 2017-11-24 09:21:57 |
| Fantom | ♥♥♥♥♥♥♥ ♥♥♥♥♥♥ player DBD | 2017-11-23 19:45:13 |
| Ghostie | morning | 2017-11-23 10:26:15 |
| Sexy Ace | racist report! | 2017-11-21 17:38:27 |
| Kura | should probably cook that spam on a skillet its better that way. | 2017-11-20 18:20:54 |
| Kura | As far as im concerned we are both champoins, we were equal bascially, gg bud | 2017-11-20 00:15:34 |
| Tommy Black | You're from Togo Morning, shut your face! | 2017-11-19 06:38:52 |
| Princess Baddie Jade | Shuddup Vegito Fanboy | 2017-11-19 06:22:27 |
| brawler | That's funny coming from a guy with Mario as his pic. | 2017-11-18 23:11:32 |
| Princess Baddie Jade | #GogetaFanBoy #DieInYourSleep | 2017-11-18 22:13:58 |
| Princess Baddie Jade | +Your profile is soooo Cringe.................. | 2017-11-18 22:06:44 |
| Princess Baddie Jade | Your profile is so stupid. Wouldn't Vegeta be the better fusion than Gogeta? He is alot stronger you doofus... | 2017-11-18 22:06:14 |
| Spartan-Stevkan | http://steamcommunity.com/groups/Son-family#announcements/detail/2922136221150110010 | 2017-11-16 08:04:24 |
| Spartan-Stevkan | *8000 | 2017-11-15 12:09:55 |
| brawler | To be fair, you have to have a very high IQ to understand Dragon Ball Z. The humor is extremely subtle, and without a solid grasp of theoretical physics most of the jokes will go over a typical viewer's head. There's also Vegeta's nihilistic outlook, which is deftly woven into his characterisation - his personal philosophy draws heavily from Kojika Volya literature, for instance. The fans understand this stuff; they have the intellectual capacity to truly appreciate the depths of these jokes, to realize that they're not just funny- they say something deep. As a consequence people who dislike Dragon Ball Z ARE idiots- of course they wouldn't appreciate, for instance, the humour in Vegeta's existencial catchphrase "It's over 9000!," which itself is a cryptic reference to Kojiya's Fathers and Sons. I'm smirking right now just imagining one of those addlepated simpletons scratching their heads in confusion as this genius unfolds itself on their television screens. Oh, how I pity them. | 2017-11-14 20:58:16 |
| Kura | Goku: "every force you create has an echo." Vegeta: "your own bad energy will be your undoing." -Gogeta | 2017-11-14 18:42:04 |
| Tommy Black | This Guy 100% stalked me when I was a kid | 2017-11-14 06:17:06 |
| Tommy Black | My favourite colour is Red because of Morning's dark past. Jirens secret power is no doubt making sure his ♥♥♥♥ gets sucked by Toppo and yeah like you said while Vegeta watches Hentai with Goku. Also you could of just made this into 1 paragrapgh instead of splitting it out, it looks kinda ♥♥♥♥♥♥ now but yea I dont mind. Oh another thing, I'mma spam your comment section with randomness now so prepare! | 2017-11-13 02:30:03 |
| Ghostie | Is your favourite colour red because mine is | 2017-11-12 19:37:51 |
| Ghostie | Ohhh nice i will too | 2017-11-12 19:37:04 |
| Ghostie | Not 100% sure tho | 2017-11-12 19:36:32 |
| Ghostie | I heard he might be making sure his ♥♥♥♥ gets sucked by toppo while vegeta wanks to hentai | 2017-11-12 19:36:15 |
| Ghostie | What is jiren's secret power? | 2017-11-12 19:35:38 |
| Ghostie | The weebs do it so i will to. Lets start a convo in the middle of your profile which should be in personal message | 2017-11-12 19:35:16 |
| Mr. 91 | daddy's ♥♥♥ dumpster | 2017-11-12 12:25:29 |
| Spartan-Stevkan | Whereas goku despises the idea of peace in all realms because there would be noone to fight and hed be bored. | 2017-11-11 04:16:31 |
| Spartan-Stevkan | Gohan is a hero. He NEVER wanted to fight, he was forced to, and even then he did it all to save his friends. Listen to him talk as he fights cell, he did not once have the thought that he had to avenge his fathers death go through his head. Because he was focused on saving his friends and the earth so their could be peace. | 2017-11-11 04:15:01 |
| Spartan-Stevkan | A truely pure of heart heroic is a rare breed. Heros are often born from the evil inside of them or from their past that turned them good and changed them, their inclination to be a hero comes from their impure heart. Goku has not changed, not even after he became a super saiyan, he was still the same person. And would have readily fought frieza again and again. To the point at which he welcomed his ressurection despite the dangers it could bring about. | 2017-11-11 04:13:41 |
| Spartan-Stevkan | Think about it though, Gokus MAIN claim to heroism is that he has saved the world. Vegeta sacrificed himself to save everyone too. Doesnt make him any less evil. | 2017-11-11 04:11:01 |
| Tommy Black | Did u read it all, or is it just too much? lmao | 2017-11-11 03:55:31 |
| Tommy Black | Yeah this place has been pretty hectic for the past 8 hours XDDD | 2017-11-11 03:54:27 |
| Tommy Black | Lol. he deleted all of his comments. | 2017-11-11 03:53:17 |
| Spartan-Stevkan | It's alright. He knows he has. He also knows he cannot win. Evident by the fact that he is leaving passive comments now. | 2017-11-11 03:50:35 |
| Tommy Black | Max you've actually started a war. You remember a few weeks ago on Sting's discord server, you started a war over ranks lol. So yeah you a hypocrite... | 2017-11-11 03:49:54 |
| Spartan-Stevkan | --> Hypocritical dumbass https://gyazo.com/6917a1e88876fe9e6ae6f91d9ae12168 | 2017-11-11 03:48:38 |
| Tommy Black | Lol, its called highlighting the most important part xD. | 2017-11-11 03:48:15 |
| Spartan-Stevkan | Ummm... that single word I wrote in caps lock?. And fyi I held shift actually. | 2017-11-11 03:47:58 |
| Tommy Black | I guess Max will always be like that lol. ain't that right Max? | 2017-11-11 03:47:01 |
| Spartan-Stevkan | There was no hostility, was a discussion between several people. A civil disputel. You wanted attention/to be a social justice warrior and "sieze hostility", noexistant hostility, hostility that was only present AFTER you arrived. | 2017-11-11 03:45:50 |
| Tommy Black | Now be calm guys, seems you've both had a good trade. lmao | 2017-11-11 03:45:01 |
| Spartan-Stevkan | Oh gee thanks, glad you could spare some. lmao | 2017-11-11 03:44:04 |
| Spartan-Stevkan | Well would you mind trading me some of your stupidity too? I seem to be a bit low... | 2017-11-11 03:43:00 |
| Tommy Black | Yeah Jelox tbh there was no need for the hostility towards Stevkan, he has actually done nothing wrong. He was just saying why he thinks Goku is not a Hero which is just a normal discussion lol. | 2017-11-11 03:40:48 |
| Spartan-Stevkan | I started no "war". Was a civil dispute on a passive topic which you decided to inject your own self into,And at that you are the one that has begun hostilities and brought about the idea that it is in any way an unfriendly conversation. Yet you tell me not to start things whem I "cant take it to a chat" yet you did not take it to a chat yourself, you commented and then responded in the comments. Seems we have a hypocritical dumbass on our hands. God save us all. | 2017-11-11 03:33:48 |
| Tommy Black | Oh god lol. My comment section tho, oh well XDDDD. :DD | 2017-11-11 03:12:25 |
| Spartan-Stevkan | Jelox not sure what your problem is, but allow me to toss you a but of advice hm? Be careful who you think you know, you may just be wrong. | 2017-11-11 00:57:45 |
| Shego | I agree. Goku is a good person but does not care about the well being of others much interdependlty from his lust for fighting cept maybe his closest friends. And he is not focused on the wellbeing of his closest friends unless the situation is dire too. | 2017-11-10 20:55:51 |
| Spartan-Stevkan | I mean for christ sake the most selfless heroic thing hes ever done was sacrifice himself to kill cell, and it took Piccolo telling him off to make him do it... | 2017-11-10 20:54:46 |
| Spartan-Stevkan | Trunks on the other hand goes put of his way to help. Didnt wanna fight cell at his max, didnt wanna fight the androids or let them be activated at all. Didnt faff about with frieza either despite him himself saying he SHOULDNT have fought him because it messed up the timeline. Trunks is a heroic person. Gohan does what he does not because he wants to fight but because he wants everyone to be safe and for there to be peace. Gohan never wanted to fight. Those are heroic people. Goku has almost none of those qualities. | 2017-11-10 20:51:21 |
| Spartan-Stevkan | Goku is not a heroic person at heart. Ask yourself WHY he saved earth. Ask yourself how many time he had to save earth because his reckless selfish decisions put earth in danger. Goku has now even put multiple universes in danger despite being warned against indulging in such a tournament. Goku is not a bad person, quite the opposite in fact. He means well. But he is no hero. | 2017-11-10 20:48:29 |
| Shego | Well Krillin fits the hero bill too. He just to weak and in the past he was no hero and is selfish. But being selfish isn't always bad and he does fit the hero bill along with Piccolo. Course Gohan and future Trunks fit the hero bill the best out of all of em for sure. | 2017-11-10 20:34:09 |
| Shego | You are forgetting Future Trunks as well in fitting the hero bill. But otherwise you are spot on. | 2017-11-10 20:30:33 |
| Tommy Black | #GokuWillAlwaysBeAHero | 2017-11-10 18:04:07 |
| Kura | Just dont ♥♥♥♥ with Goku's planet or friends and you should be okay. | 2017-11-10 17:29:15 |
| Kura | i actually have to agree with stevkan, *cringes.. | 2017-11-10 17:20:36 |
| Tommy Black | Morning isn't wrong ya know XDD | 2017-11-10 15:43:09 |
| Princess Baddie Jade | Jelox and Son Stevkan Goku is a man without wisdom and ya I love him, eyyyyy??? #AdrianFTW | 2017-11-10 15:09:46 |
| Tommy Black | He has saved earth so many times, along with sacraficing himself twice. That to me is a HERO, maybe not to you. | 2017-11-10 13:54:31 |
| Spartan-Stevkan | Pure Hearted does NOT mean you are heroic. | 2017-11-10 12:19:50 |
| Spartan-Stevkan | Goku is selfish at times, and selfless at others. He is like this NOT because he is selfish per say, but because he does what eh wants, not because he is an ♥♥♥♥♥♥♥ but BECAUSE HE IS pure hearted. He is a good person yes. But he is not a "Hero". | 2017-11-10 12:19:13 |
| IJexol™I | Tom, why did goku start the tournament of power? | 2017-11-10 12:12:46 |
| Tommy Black | He's PURE HEARTED that kinda shows that he's heroic, so stevkan your point is pretty invalid buddy... | 2017-11-10 11:04:50 |
| IJexol™I | goku is either a hero or fighter. you never know. | 2017-11-10 10:54:28 |
| Tommy Black | Never even said Goku or Vegeta were heroes, just saiyan if I had to place the 'SSGSS' form in a category between GOOD or EVIL, then obviously I would put it in the section of 'GOOD' lol. And yes Goku is an actual Hero. | 2017-11-10 09:57:26 |
| Spartan-Stevkan | Goku is NOT a hero. lol. Nor is Vegeta. The only real HERO character in Dragon Ball is Gohan. He is the only one with a Heroic mindset and actually fits the billl for a HERO. | 2017-11-10 08:59:15 |
| Tommy Black | Nope, the transformation itself matters to me. | 2017-11-10 08:20:44 |
| IJexol™I | doesn't matter the transformation itself. only matters how much of a badass you look in the end. | 2017-11-10 07:22:44 |
| Tommy Black | So basically, Super Saiyan Blue is my favourite Hero form and Super Saiyan Rose` is my favourite Villian form. Funny how I like both of these forms the best, yet they are eachothers counter parts lol. | 2017-11-10 03:49:55 |
| IJexol™I | +rep this brit is a genius rocket league player. | 2017-11-09 09:02:18 |
| Spartan-Stevkan | "Ssgss best form" "Cotton candy pink as profile" | 2017-11-09 06:01:15 |
| Spartan-Stevkan | Yeah I mean you think hed be able to seeing as he already takes ♥♥♥♥. lololol | 2017-11-08 19:52:47 |
| brawler | Learn to take a joke? | 2017-11-08 19:51:39 |
| Kura | shut up stevkan | 2017-11-08 18:24:59 |
| Spartan-Stevkan | =Rep cucked me so hard I got shot into the dimension of theCucked Duck | 2017-11-08 17:11:02 |
| brawler | +rep Never thought a Brit could be so kind. | 2017-11-08 17:09:04 |
| Spartan-Stevkan | I concur. | 2017-11-07 19:02:26 |
| Kura | Not gonna end up the losers!!We're gonna show all the rulers!!Right here on Dragon Ball Super!!!We're all it takes to blow Zen-Oh away!! >:D | 2017-11-06 21:52:42 |
| laura ♡ | olie | 2017-11-06 19:55:06 |
| Tommy Black | Damn you Brawler lol. | 2017-11-06 17:15:12 |
| brawler | #SSGSS Is the best from, Always will be. #SSGSS is the worst form, always will be. Fixed it. :D | 2017-11-06 17:13:13 |
| IJexol™I | i guess there is room to change, but that will take some time. | 2017-11-06 06:34:52 |
| Tommy Black | Ohhh XDD. thats all gone now man. | 2017-11-05 17:47:54 |
| Kura | this Jentes thing not that lol. | 2017-11-05 17:46:32 |
| Tommy Black | Love it Swing Lynn. Its SSGSS Goku, you gotta love him! | 2017-11-05 17:45:21 |
| Kura | wtf is this, i dont like this one bit. | 2017-11-05 17:43:35 |
| Pat Noel | I love you Tommy. We are part of Jentes religion! | 2017-11-05 13:01:43 |
| Vencut | i smell like cheese | 2017-11-05 13:01:41 |
| Ghostie | jendrew | 2017-11-05 13:00:30 |
| Tommy Black | You too my good friend. | 2017-11-05 10:04:53 |
| BurntOutBulb | It is good to have you back my dank friend. | 2017-11-05 09:41:07 |
| Burnt. | Hell yeah that'd be cool.. | 2017-11-03 15:02:26 |
| Tommy Black | Smacking* | 2017-11-03 15:01:29 |
| Tommy Black | Ah yeah, just imagine that lol. Beerus smaking Goku in the face as a SSGSS and he takes it like that...That would truly give me a boner since this form is my favourite...MAKE HIM MORE MIGHTY TORIYAMA. | 2017-11-03 15:01:16 |
| Burnt. | I knew it was Golden Frieza, but Beerus' arm band or whatever is also that color so it's kind of funny. I just imagine Beerus trying to punch Goku in SSGSS and having that happen now. | 2017-11-03 14:51:10 |
| Tommy Black | But clearly you can see the Golden arm, maybe if the hand was just shown then I could be having difficluties telling but yeah as I said arm golden = Instant Golden Frieza in my eyes. | 2017-11-03 14:35:59 |
| Burnt. | For some reason your profile picture looks like Beerus instead of Golden Frieza | 2017-11-03 14:12:33 |
| Burnt. | Oh, mk. | 2017-11-03 14:11:58 |
| Tommy Black | Yesterday | 2017-11-03 03:28:35 |
| Burnt. | When did ya boi unfriend me? | 2017-11-02 22:30:04 |
| Ghostie | Last 2 days, this sad man has left xenoverse 2 on all night | 2017-11-02 21:38:08 |
| Tommy Black | What do you mean Brawler? | 2017-11-01 17:27:57 |
| brawler | I personally prefer Tide. | 2017-11-01 17:07:52 |
| Kura | https://www.youtube.com/watch?v=DaIUbeDAHdM | 2017-11-01 14:18:07 |
| Spartan-Stevkan | Minecraft is my city | 2017-11-01 07:43:33 |
| Tommy Black | Oh yeah, Beerus I will. Don't you worry about that. #CloroxIsMyFavouriteRefreshment | 2017-11-01 07:21:31 |
| Spartan-Stevkan | Lololol | 2017-11-01 05:58:15 |
| Spartan-Stevkan | Imagine Rock trying to beat Stevkan. Brendon is toast. | 2017-11-01 05:58:11 |
| Kura | imagine super saiyan blue ultra instinct. Jiren is toast. | 2017-11-01 00:21:10 |
| Spartan-Stevkan | https://youtu.be/GiU9XLT__O4 | 2017-10-31 11:53:27 |
| Tommy Black | Impressive | 2017-10-31 11:48:56 |
| Spartan-Stevkan | https://steamuserimages-a.akamaihd.net/ugc/854982495377634541/C8F0C2DC49F64D7FB17E9A26CAB3E1F2A56E39E2/ | 2017-10-31 11:46:25 |
| Tommy Black | Yep | 2017-10-31 11:44:27 |
| Spartan-Stevkan | Sandpaper dildio.? | 2017-10-31 11:43:24 |
| Tommy Black | Yeah. Im a god doe. you know this Stevkan | 2017-10-31 11:42:18 |
| Spartan-Stevkan | *ssgss* *nothing to do with gods on profile* | 2017-10-31 11:33:40 |
| Leex | +rep note: stop flying like superman in rocket league jeez dude | 2017-10-31 09:17:10 |
| Tommy Black | Thanks Beerus. I will be holding a giveaway next Tuesday so be sure to HIT that notifcation bell so you get the news ASAP. | 2017-10-30 16:47:30 |
| Tommy Black | The only ARC in DBS I found good was the Goku black arc. Wbu? oh and of course Super Saiyan Blue from the movie, I loved that too. Apart from that it's not comparable to DBZ. | 2017-10-30 16:46:17 |
| Kura | i dont mind DBS but its complete crap compared to Z. | 2017-10-30 16:44:22 |
| Ghostie | guys, negative energy is a bad thing okay. Brawler, let talk with you and settle things with you. It is all okay my man | 2017-10-30 16:43:29 |
| brawler | Because it is ♥♥♥♥. DBS designs are something out of ♥♥♥♥♥♥♥ DeviantArt. | 2017-10-30 16:38:59 |
| Tommy Black | Jheez. the hate on Super Saiyan Green LMAO | 2017-10-30 13:03:11 |
| Kura | SSGSS (super saiyan green super saiyan) lol.. (kill me) | 2017-10-30 02:00:18 |
| Tommy Black | That could be an option. Thanks Brawler LoL | 2017-10-29 13:00:13 |
| brawler | Ayy, what's next? Super Saiyan Grapefruit! | 2017-10-29 12:59:33 |
| brawler | V | 2017-10-29 12:58:04 |
| Spartan-Stevkan | Because its ♥♥♥♥. Plain and simple. boring, lacking in entertainment, one sided, every design is made purely so they can sell toys. The producers get their storylines from the runoff drafts they find in the dumpsters outside of nicktoons studios. Goku is mentally retarded. and all the good characetrs are criminally underused. Unlike Z it has no real emotion no real stakes and goku is an all mighty super god that cannot lose. No blood. No cursing. No real violence. Just like Backyardigans and little bill, when you are younger you watch it and think its the ♥♥♥♥. But when yi get older and have a well developed intellect, you rewatch them and realize how dumbed down and lazy they are. same goes for super. Its for children. Case closed. | 2017-10-29 11:38:39 |
| Spartan-Stevkan | Has to be the ugliest ♥♥♥♥ ever. Broly can pull it off but he was a limeish green. That ♥♥♥♥ is just ugly. | 2017-10-29 11:27:18 |
| brawler | Super Saiyan Green? Please go jump off a cliff, you disgusting ♥♥♥♥♥♥. | 2017-10-29 10:23:22 |
| Spartan-Stevkan | I THINK WE ALL NEED TO CALM DOWN AND BURN THE CHILDREN | 2017-10-27 13:36:50 |
| Tommy Black | #1YearAnniversaryForXenoverse2 #NoUpdate | 2017-10-27 13:22:04 |
| Spartan-Stevkan | I think we should all slit our wrists and end this facade. :D | 2017-10-27 08:55:00 |
| BurntOutBulb | Got me jeebie weebies so I cuold get pot zoned off the stinky brinky skunk skunk +rep, also made part 4 jason a thing. | 2017-10-26 16:18:00 |
| Kura | skye be nice! x3 | 2017-10-26 04:34:45 |
| Tommy Black | Claw claw hiss hiss to you too Skye-Lynn :D | 2017-10-26 02:17:43 |
| stop looking at me | Claw claw hiss hiss | 2017-10-25 22:11:07 |
| Princess Baddie Jade | SSGSS FTW | 2017-10-25 20:45:47 |
| Tommy Black | Thanks my furry friendZ | 2017-10-25 17:37:04 |
| Vencut | cheesy person | 2017-10-25 17:34:58 |
| Kura | <: 3 | 2017-10-25 04:08:20 |
| Tommy Black | Ah Like I did on your profile xD | 2017-10-25 04:07:56 |
| Kura | oh im jsut being campy and slightly edgy dont mind me >:V | 2017-10-25 03:57:04 |
| Tommy Black | Swing Lynn* my bad LoL | 2017-10-25 03:49:40 |
| Tommy Black | Swynn linn is offcialy Bisexual. I didn't need to know that XD, but its fine Swinn my man. | 2017-10-25 03:48:30 |
| Tommy Black | Oh...I cleared out my friends list about 2 weeks ago, guess you were removed too. sorry friend. | 2017-10-25 03:44:10 |
| Voidolt | hey why you deleted me before? i like ur screenshots :c if you don't wanna keep me then its fine. | 2017-10-24 19:36:26 |
| Kura | penis or vagina? i lieekke both its badass | 2017-10-24 19:12:13 |
| Tommy Black | I am sorry my good friend. it's just that I love hakz, dont tell Phyconix doe or I will hakz ur account | 2017-10-24 16:40:51 |
| Ghostie | bud, bud, bud. I know you mean well black helca, but sorry to break it to you that is not vegito. I really think rewatching the series might help | 2017-10-24 15:21:05 |
| JELLAL FERNANDES | +rep. Gotta love vegitto | 2017-10-24 15:14:14 |
| IJexol™I | R TO THE U TO THE S TO THE T, BOI IF YOU DON'T PAY BACK THE FEE, YOU WILL HAVE TO DEAL WITH THEE, WHICH DO NOT RESPECT PRIVACY. | 2017-10-24 10:55:42 |
| Spartan-Stevkan | You've gone too far this time. Now you gotta deal with me. | 2017-10-24 06:54:47 |
| Tommy Black | I've accepted guys. Sorry I've been away for 8 days lol :D. But I'mma back. | 2017-10-23 12:34:55 |
| Nico | why decline ? :'( pls accept friend requst | 2017-10-21 03:19:21 |
| ayri fik | It went from Super Saiyan God to Rose to Ultra now Blue. Kms Lmao | 2017-10-19 23:10:46 |
| Sexy Ace | weebs go to hell | 2017-10-19 12:28:31 |
| Sexy Ace | b a n n e d | 2017-10-16 13:41:54 |
| Kura | its all good man lol. just give ya a hard time xD | 2017-10-15 21:56:44 |
| Tommy Black | Sorry Swing-Lynn my main man, thought it looked really dank so I used it :D | 2017-10-15 13:01:36 |
| Kura | you stole my old profile pic you bastard. lol | 2017-10-15 05:27:12 |
| IJexol™I | +rep best bud | 2017-10-08 08:58:18 |
| Kuzey Fırtınası | +rep | 2017-10-07 10:47:58 |
| Tommy Black | WTF....lmao | 2017-10-04 12:34:51 |
| brawler | +rep Decent human bean | 2017-09-30 23:02:19 |
| laura ♡ | I agree | 2017-09-30 13:49:40 |
| Tommy Black | ehhh. Nah lol. | 2017-09-30 02:52:35 |
| brawler | Looks very mad. | 2017-09-29 21:59:52 |
| brawler | -Rep ♥♥♥♥♥♥ up the accent on Rosé. | 2017-09-28 14:39:28 |
| Mr. 91 | naygoo | 2017-09-27 21:04:05 |
| Tommy Black | That Sarcasm though | 2017-09-26 14:22:18 |
| BurntOutBulb | +rep uses the very fair and balanace combat stance as Jason. | 2017-09-26 14:21:32 |
| BurntOutBulb | -rep stole all my weed and doinks I was gonna smookey wookey and get totally krunky with. | 2017-09-26 14:13:47 |
| Princess Baddie Jade | How do I buy F13...I have the money but where do I go to buy it? | 2017-09-22 18:28:19 |
| sram | +rep | 2017-09-22 17:40:27 |
| Tommy Black | Nope, I would never do such a thing. Well at least I have a pink shirt, so that at least goes with my 'Rose` theme' | 2017-09-22 02:58:58 |
| brawler | Die your hair pink. | 2017-09-21 22:13:50 |
| BurntOutBulb | dead by deadlight nub i ♥♥♥♥ ur mothur | 2017-09-20 13:47:09 |
| Redlight | +rep helped him get closer to his badge | 2017-09-20 09:49:20 |
| Burnt. | +REP For our justice! | 2017-09-19 23:36:34 |
| Princess Baddie Jade | Your Profile sucks, who even likes Super Saiyan Rosé Goku? He is the worst. | 2017-09-19 18:02:45 |
| Tommy Black | ikr | 2017-09-17 17:53:57 |
| Shego | wish we could have gif avas on steam too lol | 2017-09-17 17:52:23 |
| Tommy Black | +Rep | 2017-09-17 17:50:38 |
| Tommy Black | Sure | 2017-09-17 14:38:44 |
| Nico | +rep pls Me +rep thank you :) | 2017-09-16 14:17:53 |
| Tommy Black | It's called changing. jesus... | 2017-09-15 17:31:25 |
| brawler | Name: Baby VegetaPicture: Future GohanOk then.... | 2017-09-15 17:28:25 |
| Tommy Black | :) | 2017-09-14 10:28:28 |
| Tommy Black | It's the real Baby Vegeta lol (CANON) | 2017-09-14 08:08:24 |
| Ghostie | You look very sick and ill man.i think you need water and to exit the cave | 2017-09-13 15:04:32 |
| Tommy Black | Sounds interesting. Have fun! :) | 2017-09-13 04:28:18 |
| Shego | I am getting borderlands the pre sequel by thurs or fri. And I am playing warthunder now too cause of a old coat that loves that game getting her discord peers into it. she has played wt for 5 years. That more time than xv2 fiends that even fiended over xv1 too | 2017-09-12 19:56:46 |
| Tommy Black | Thanks! | 2017-09-12 17:32:58 |
| brawler | Kewl | 2017-09-12 17:13:36 |
| Tommy Black | I am watching the Sub along with the DUB now. It's too painfull waiting a week for a single episode to release. Despite having to wait for DUB, SUB isn't even that bad. And if you were thinking about getting F13, don't get it now, it has way too much bugs and it seems like it's getting worse. I would say 6 months from now would be the perfect time to get this game, more content would be released as well as bug fixes. | 2017-09-12 04:27:16 |
| Shego | I also hate how I can't edit comments on steam. Like wtf. That's so stupid. People make typos and ♥♥♥♥. | 2017-09-12 01:31:31 |
| Shego | Perhaps that part of the cost lol. but i am not paying no 40 dollars for no borderlands pre sequel. Or wait for a sale when I can get the disc for 10 lol. | 2017-09-12 01:12:38 |
| Shego | The community in Steam is good despite my issues with download prices for some games. | 2017-09-12 01:11:10 |
| Shego | I have to watch the dub now. Cause i am curious to Hit's voice actor in it. | 2017-09-12 01:10:37 |
| Shego | F13 does not look like my kind of game. | 2017-09-12 01:08:24 |
| Tommy Black | :). cuz I suck at F13 | 2017-09-11 03:04:47 |
| BurntOutBulb | P2W JAYSIN USER, rEPROTED | 2017-09-09 17:05:40 |
| Tommy Black | lmao. fair enough. | 2017-09-09 08:19:50 |
| fsociety | yeah maybe...its just when i saw your pic i instantly though of that dude :D | 2017-09-09 08:17:10 |
| Tommy Black | hair | 2017-09-09 08:15:28 |
| Tommy Black | Not really lmao. we got the same colour thats it. | 2017-09-09 08:14:20 |
| fsociety | its okay..just admit it | 2017-09-09 08:13:25 |
| Tommy Black | nope | 2017-09-09 08:11:45 |
| fsociety | http://i.dailymail.co.uk/i/pix/2014/06/24/article-2668481-1EE9CACB00000578-11_318x458.jpg umm hello? :D | 2017-09-09 08:08:42 |
| fsociety | lmao you kinda looks like the cancer guy from the fall in our stars..just sayin :D | 2017-09-09 08:06:01 |
| Tommy Black | xD | 2017-09-08 17:19:41 |
| joshoowah | Team killers. | 2017-09-08 17:14:33 |
| Tommy Black | hahaha. Thanks bills. | 2017-09-08 12:36:02 |
| Tommy Black | Just a normal facial expression xD. I don't look angry lmao | 2017-09-08 11:37:10 |
| Ghostie | One angry manchild right here | 2017-09-08 10:59:53 |
| IJexol™I | please for the love of god just let me in the group... all i am asking... | 2017-09-04 09:52:43 |
| Princess Baddie Jade | So I am back after 6 weeks. Feels good | 2017-08-30 17:44:55 |
| Hyper Mania | Have a good weekend | 2017-08-27 12:24:11 |
| Blazinbanjo#savetf2 | uhhh yea cool guy and such like dragon ball z as u can tell | 2017-08-27 12:21:36 |
| Ghostie | Hello my friend, this is the administrator of ♥♥♥♥♥♥♥™.We have noticed that you have cancelled your subscription payment this month. As one our best clients, we ask you to renew your subscription as we offer you 50% discount. And as always we have updated gay section for your desires. See you soon! | 2017-08-24 13:30:23 |
| DizzyX | ENES ABİANAMı SİK :DD | 2017-08-23 13:08:30 |
| Vencut | Racist | 2017-08-21 19:28:02 |
| Milk | ║\ ║▒\ ║▒▒\ ║░▒║ ║░▒║ put this ║♥♥♥ ║ on your friends║░▒║ profile ║♥♥♥ ║ to protect them║░▒║ against ♥♥♥♥♥♥♥║♥♥♥ ║ and jews║░▒║ ▓▓▓ [█▓] [█▓] [█▓] | 2017-08-19 19:49:52 |
| RealKawaNinja | +rep Best Brit Friend | 2017-08-19 13:36:15 |
| HiddenWolf | +rep best teamkiller F13 hands down | 2017-08-17 13:34:09 |
| Vencut | +rep Hate this guy | 2017-08-17 13:32:20 |
| brawler | -rep Is a Transgender Avacado Feminist. | 2017-08-15 16:44:12 |
| ElbrUx13 | a great f13 player | 2017-08-15 07:13:28 |
| Ghostie | So jelous of his profile | 2017-08-14 14:17:52 |
| Spartan-Stevkan | ♥♥♥♥ | 2017-08-14 08:31:23 |
| Spartan-Stevkan | gay | 2017-08-10 09:09:25 |
| Madbank6 | トマス eh? Noice | 2017-08-06 23:18:44 |
| Pat Noel | smells like someone hiding in a burito in WW2 | 2017-08-05 13:43:31 |
| IJexol™I | look. i am sorry for what was done, but the fact is i talk with people in the same way as theirs. joey has gone too far and i did as well... and don't forget about those comments you posted on my profile...... | 2017-08-05 12:28:04 |
| IJexol™I | He needs some milk | 2017-08-05 12:02:36 |
| Mr. 91 | he is a piece of living wank material | 2017-08-04 17:15:48 |
| IJexol™I | Best brit beaver bet b8/b8 | 2017-08-04 11:46:22 |
| Tommy Black | ty | 2017-08-03 12:27:43 |
| Kura | nice profile pic lol. | 2017-08-03 11:21:59 |
| IJexol™I | #krillinit OOPS, WRONG COMMENT SECTION | 2017-07-31 10:23:49 |
| Leex | +rep a friend who got more haters than lovers | 2017-07-31 09:42:01 |
| WTF?! | -rep сосет ♥♥♥♥♥♥ | 2017-07-23 10:36:05 |
| Ruslan_996 | ♥♥♥♥♥♥♥ fascist kills the first Russian ♥♥♥♥♥ | 2017-07-22 06:47:42 |
| postpunke monke | I left because I wanted to be Jasonand I wasnt♥♥♥♥♥♥ | 2017-07-21 07:54:42 |
| Mr. 91 | 10/10. such an awesome teammate in Rocket League! | 2017-07-21 06:31:49 |
| BurntOutBulb | 10/10 fixes the phone box every time. | 2017-07-21 02:51:11 |
| Mr. 91 | Had tons of fun with Tommy on Dad dont touch me there, oh god, atleast use lube simulator | 2017-07-17 18:26:11 |
| BurntOutBulb | +rep morph god with Jason | 2017-07-16 09:59:07 |
| Slimow | I juked this guy like 10minuts when he was jason +rep | 2017-07-16 09:52:29 |
| Oh Hi Mark | +13 | 2017-07-16 08:24:14 |
| Erich Zann | - rep - monitoring in F13 the Game. | 2017-07-16 06:56:51 |
| IJexol™I | BRITISH PRICK DETECTER IS OFF THE CHARTS! | 2017-07-16 04:32:14 |
| Ghostie | This is a guy who just nothing but necks it out on games for hours alone | 2017-07-15 18:12:11 |
| ehabmostafa | rep+niceguy at xenoverse 2 | 2017-07-15 08:43:35 |
| Pat Noel | 10/10 would smell again ;) | 2017-07-14 17:25:20 |
| Mr. 91 | +rep My guy knows how to show another guy a good time for less than a nickel and a dime! | 2017-07-08 21:48:52 |
| IJexol™I | "You hate the fact that you're powerless to stop me. That you're completely outmatched. Well, imagine feeling the way you do now all of the time like the people of this planet do. Fools. How do you think my master Gohan felt when you ganged up on him in the rain and he had no way out? Well, now it's your turn. I hope you enjoy it!" | 2017-07-08 08:38:59 |
| Tommy Black | How would you know that. You don't even own the game, also stop spamming on my profile please. It's really annoying :) | 2017-07-08 07:16:52 |
| Princess Baddie Jade | Best Xenoverse 2 player. He's alot better then most people I play. +rep Tommy. | 2017-07-08 07:13:48 |
| Ghostie | Known for leaving games on for hours | 2017-07-07 08:50:22 |
| Tommy Black | Sorry Morning. I don't own Overwatch | 2017-07-07 07:18:28 |
| Princess Baddie Jade | lad +rep great times on overwatch | 2017-07-07 07:15:49 |
| Tommy Black | Ummm, ok... | 2017-07-06 09:47:56 |
| Princess Baddie Jade | Hi. This is Morning AKA Andrew Black. Could you please accept my friend request? | 2017-07-06 09:22:47 |
| Tommy Black | How am I a hacker? | 2017-07-02 11:04:36 |
| ViperMan | -rep hacker in frifdaz | 2017-07-02 10:50:25 |
| Tommy Black | Hello. We should fight on Xenoverse once you accept my friend request. Let the mirror match begin! | 2017-07-02 03:14:35 |
| IcebergXI | Noticed you added me, so, hi potentially other me? | 2017-07-02 00:04:37 |
| Tommy Black | Louise wasn't mad. It was your clown friends talking ♥♥♥♥ to him saying 'I will kill you but leave the rest to survive'. Kind of a ♥♥♥♥ move, RIGHT? | 2017-07-01 18:36:46 |
| KarmaDevil | Can i ask you a question? Why is Lojze so mad? he ruined my day | 2017-07-01 18:27:37 |
| BurntOutBulb | +rep 3cool5me Really fun to play with. | 2017-06-26 23:59:03 |
| IJexol™I | +rep *I'll be there for you plays* So no one told you life was gonna be this wayYour job's a joke, you're broke, your love life's D.O.A.It's like you're always stuck in second gearWhen it hasn't been your day, your week, your month, or even your year, butI'll be there for you(When the rain starts to pour)I'll be there for you(Like I've been there before)I'll be there for you('Cause you're there for me too) | 2017-06-26 04:22:13 |
| boyyyy | jizzface | 2017-06-24 17:21:54 |
| Slimow | Good guy to play with, very funny ! | 2017-06-23 13:24:46 |
| Klang | Awesome guy! | 2017-06-21 18:05:51 |
| IJexol™I | VANESSA in the MESSA. (♥♥♥♥♥♥♥ kill me, jason) | 2017-06-20 08:49:39 |
| IJexol™I | It's just crippling depression. i blame the memes. | 2017-06-19 07:46:31 |
| Doctor Molestaro | "chi chi chi ka ka ka" | 2017-06-17 10:45:47 |
| YARGYS | you noobs | 2017-06-15 14:26:16 |
| zilly | +rep Good F13 player, nice dude. | 2017-06-14 09:08:05 |
| Tommy Black | 2 people on my friends list have over 300 hours... | 2017-06-14 05:17:43 |
| ssj_vegeta_jm2000 | F13th has been out for like 19 days and the amount of hours you have means you play like 13 hours a day, sounds unhealthy bro plz take care, world needs every F13 fan it has!!!! | 2017-06-13 19:57:49 |
| ElbrUx13 | +rep more than a friend,more than a person,more than a gamer <3 :D | 2017-06-13 13:41:46 |
| BurntOutBulb | +rep 3cool5me | 2017-06-10 15:43:07 |
| Biker | + rep | 2017-06-08 16:16:21 |
| blood | +rep secksee | 2017-06-08 12:31:38 |
| Tommy Black | But I was. | 2017-06-07 07:58:19 |
| Suddenly Josh | Nobody with 10 hours is a god at the game, ggs | 2017-06-06 13:53:53 |
| Kylee The Sadist | Oh dat handsome profil pic | 2017-05-31 12:22:56 |
| NN | Ты играл днями и ночами в пятницу? Глаза не вытекли? | 2017-05-31 03:47:05 |
| fsociety | 1 more day!! | 2017-05-25 08:40:44 |
| Tommy Black | Yeahhhh! | 2017-05-24 08:24:08 |
| Kylee The Sadist | 2 days left | 2017-05-24 07:42:24 |
| IntricateGod | Anyone by chance selling a code? Man I hate I just found out about this game :( | 2017-05-23 20:50:54 |
| AnotherGerman | See you at Camp Crystal Lake | 2017-05-23 19:01:39 |
| Ghostie | Alright skilled mug? | 2017-05-22 08:31:35 |
| Jad035 | I would love to join ur group | 2017-05-14 13:36:39 |
| Eutopia | hi Kakarotto | 2017-05-06 07:05:26 |
| Ghostie | CRABS IN A BUCKET | 2017-04-22 15:18:41 |
| Tommy Black | No problem :) | 2017-04-14 13:39:09 |
| YANG64 | OK,Good.Thanks for the add.Enjoy the games,We can try playing more good games. | 2017-04-14 08:26:44 |
| Tommy Black | :) | 2017-04-12 14:53:49 |
| fsociety | Everytime i see someone call Chris ''Jenny'' because of the game..i lost little bit of my soul. :'( | 2017-04-12 14:45:17 |
| Tommy Black | FOR SURE! | 2017-04-10 06:12:06 |
| Silent Croft | Nice Jenny! I wait for play with you friday ;) | 2017-04-10 05:54:04 |
| Silent Croft | Hi Jenny I survive of crystal lake but now i watch jason how to escape them ? oh no no no!!!!!!! (LINE STOPPED) | 2017-04-10 05:52:27 |
| kek | -rep | 2017-04-06 16:44:47 |
| Tommy Black | Tuesday 24th March 2017- Last Harry Potter I watched! | 2017-03-14 15:29:33 |
| Tommy Black | Very good game. Best dragonball Z game ever to exsist :) | 2017-02-09 05:23:03 |
| Upgrade | hows xenoverse 2 been treating you? | 2017-02-09 00:38:44 |
| xkOOndziu | Best teammate ! +REP | 2017-02-08 13:02:44 |
| Princess Baddie Jade | DESTRUCTO DISK! | 2017-02-02 07:34:12 |
| Ghostie | andrew and you are gay boys | 2017-01-30 18:09:13 |
| Ghostie | So how is they hunger, the ssj god ssj, beta bucks, jelous of xenos and morning cruise? Besties for life i believe. | 2017-01-30 08:21:03 |
| IJexol™I | Where have u bean my buddy ol' pal? Did you get hacked again? Still like you. +rep | 2017-01-18 08:42:06 |
| wh... | +rep :) | 2017-01-05 12:10:42 |
| TIMASU | Team killing in Friday the 13th... gj ♥♥♥♥♥♥♥ idiot | 2016-12-24 09:39:03 |
| Tommy Black | That ',' was not needed... | 2016-12-14 09:36:44 |
| Contact Front | this profile is home to a pure sweaty basement nerd that starves himself, saving his dinner money up | 2016-12-14 08:52:54 |
| Contact Front | who's this korean looking mofo in your display picture? | 2016-12-13 19:12:11 |
| Princess Baddie Jade | hello? | 2016-12-13 17:40:34 |
| Ghostie | why do you share your steam account with a 1 year old baby that is half rat and half human that constantly requires adrian's attention? | 2016-12-12 10:30:43 |
| LUCKYRiCK | You forgot to private your profile m8! | 2016-12-06 12:40:17 |
| Contact Front | jippo fripp | 2016-11-24 19:47:12 |
| Regina Díaz | your profile looks awesome | 2016-11-19 16:27:20 |
| Misato Katsuragi's Feet | Your friend http://steamcommunity.com/id/WhizzleSWE/ is a scammer. | 2016-10-24 13:29:53 |
| bass | What can you tell me about this DEMOGORGON? He added me and commmented "u left great comments , y i reqesyed ur badd ass". | 2016-09-19 10:53:41 |
| Upgrade | cheers dude ^_^ try the newer ghost in the shell game | 2016-09-18 14:08:27 |
| RoBBiN | Good Guy | 2016-09-17 06:58:30 |
| ADAM 84 | camper get a cancer... retarder | 2016-09-01 04:35:54 |
| Ghostie | https://i.ytimg.com/vi/qpds1gFlGq8/maxresdefault.jpg | 2016-08-25 15:43:21 |
| TheGamingRodent64 | LADETTE | 2016-08-16 13:18:08 |
| Ghostie | https://www.facebook.com/thomas.fripp.1?fref=ts | 2016-06-18 12:23:03 |
| Tommy Black | cheers bro! | 2016-06-17 13:20:02 |
| Andrew3934 | Your a great guy man. It had been so long since I found someone on steam or even the internet who is as cool as you. | 2016-06-17 12:05:27 |
| Ghostie | Your king is wating in his king sized bed with his cobra out | 2016-06-12 09:52:25 |
| Princess Baddie Jade | Lad + REP. | 2016-06-04 05:03:00 |
| ^5 | camperbastard play pokemon | 2016-05-13 01:49:36 |
| Defreid | ez to rape you | 2016-05-01 08:59:31 |
| gYdra | ez | 2016-05-01 07:33:51 |
| Tommy Black | :) | 2016-04-06 16:45:03 |
| neo from matrix | y can't i :( | 2016-04-05 06:54:26 |
| Ghostie | great guy! rep + | 2016-02-28 14:40:12 |
| Friend | FriendDate | UnfriendDate |
|---|---|---|
 Àchilles | 2024-05-28 17:26:35 (33 days) | N/A |
 76561199331200393 | 2024-05-22 21:08:42 (39 days) | N/A |
| 76561198034044645 | 2024-05-22 06:51:24 (40 days) | N/A |
 Gon Freecss | 2024-05-22 06:47:13 (40 days) | N/A |
 Yusuke | 2024-05-22 06:31:32 (40 days) | N/A |
| 76561198251139022 | 2024-05-20 11:33:08 (41 days) | N/A |
| 76561197983875116 | 2024-05-07 05:44:38 (55 days) | N/A |
| 76561198077788414 | 2024-05-06 06:50:32 (56 days) | N/A |
 Kanashimi | 2024-05-06 03:29:32 (56 days) | N/A |
| 76561199096669235 | 2024-05-05 09:41:23 (56 days) | N/A |
 Princess Zelda | 2024-05-05 09:41:02 (56 days) | N/A |
| 76561198051246540 | 2024-04-29 15:34:06 (62 days) | N/A |
 Sidroe | 2024-04-29 11:29:00 (62 days) | N/A |
 Jexol | 2024-04-26 21:27:21 (65 days) | N/A |
 ZHILEI "BIG BANG" ZHANG | 2024-04-15 20:41:26 (76 days) | N/A |
 BFFR | 2024-03-31 13:42:39 (91 days) | 2024-04-07 09:41:44 (84 days) |
 dwight x david fanfic | 2024-03-31 11:58:53 (91 days) | 2024-04-07 09:41:44 (84 days) |
 Frostly | 2024-03-31 11:18:16 (91 days) | 2024-04-07 09:41:44 (84 days) |
 Average Kate Main | Bloodycase.c | 2024-03-31 10:50:28 (91 days) | 2024-04-07 09:41:44 (84 days) |
| 76561199091306207 | 2024-03-30 20:20:56 (92 days) | 2024-04-07 09:41:44 (84 days) |
| 76561198022597346 | 2024-03-30 02:20:27 (93 days) | 2024-04-06 08:24:14 (86 days) |
 ♡Elle♡ | 2024-03-29 17:23:47 (93 days) | 2024-04-06 08:24:14 (86 days) |
 pauloandrade224 | 2024-03-29 14:06:50 (93 days) | 2024-04-06 08:24:14 (86 days) |
 ATOMICNIC | 2024-03-26 16:43:44 (96 days) | 2024-04-06 08:24:14 (86 days) |
 WAZAAAAAAA | 2024-03-26 14:47:50 (96 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199092608217 | 2024-03-26 14:46:08 (96 days) | 2024-04-07 09:41:44 (84 days) |
 eggbye inc. | 2024-03-26 11:36:04 (96 days) | 2024-04-07 09:41:44 (84 days) |
 iSandy | 2024-03-24 18:34:54 (98 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199092464460 | 2024-03-24 16:05:21 (98 days) | 2024-04-06 08:24:14 (86 days) |
 Jo | 2024-03-24 15:58:47 (98 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198981926548 | 2024-03-24 15:40:29 (98 days) | 2024-04-07 09:41:44 (84 days) |
 gorlock the destroyer | 2024-03-24 12:02:15 (98 days) | 2024-04-07 09:41:44 (84 days) |
 Nxtrify | 2024-03-24 11:15:58 (98 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198138773938 | 2024-03-24 09:49:43 (98 days) | 2024-04-06 08:24:14 (86 days) |
 Psychomaniac | 2024-03-23 13:53:56 (99 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199140338832 | 2024-03-22 21:53:10 (100 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198987333572 | 2024-03-22 20:08:52 (100 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199284242048 | 2024-03-19 04:43:53 (104 days) | 2024-04-06 08:24:14 (86 days) |
 🔞𝕂𝔸𝕋𝔸ℕ𝔸🔞 | 2024-03-09 14:20:47 (113 days) | 2024-04-07 09:41:44 (84 days) |
 Tommy C | 2024-02-29 13:33:36 (122 days) | N/A |
 JasonHooft | 2024-02-10 22:21:17 (141 days) | 2024-04-07 09:41:44 (84 days) |
 SpyMaraj | 2023-12-17 10:34:55 (196 days) | 2024-04-16 14:01:07 (75 days) |
 Eu4 Methaddicted Gooner | 2023-11-21 14:56:31 (222 days) | 2024-04-06 08:24:14 (86 days) |
 Sniper Queen | 2023-10-26 05:25:55 (249 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199500486554 | 2023-10-13 05:14:09 (262 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198825499651 | 2023-10-13 05:14:09 (262 days) | 2024-04-06 08:24:14 (86 days) |
 dess ♥ | 2023-10-11 02:19:41 (264 days) | 2024-04-06 08:24:14 (86 days) |
 Cool Pita Boy | 2023-10-06 22:03:52 (268 days) | N/A |
| 76561198107996909 | 2023-10-06 17:12:29 (268 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199202849282 | 2023-10-05 09:04:14 (269 days) | 2024-04-06 08:24:14 (86 days) |
 Ivan | 2023-10-03 14:15:24 (271 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199025593949 | 2023-10-03 09:20:28 (271 days) | 2024-04-06 08:24:14 (86 days) |
 Buttsex Bandit (Selling)[Sourcebans MARK] | 2023-10-02 01:00:18 (273 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198808155160 | 2023-09-29 19:06:20 (275 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198157961360 | 2023-09-29 09:08:28 (275 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198882290594 | 2023-09-29 00:46:41 (276 days) | 2024-04-07 09:41:44 (84 days) |
| 76561198997252089 | 2023-09-27 02:23:27 (278 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199114808849 | 2023-09-23 16:44:13 (281 days) | 2024-04-06 08:24:14 (86 days) |
 woundfucker | 2023-09-23 15:21:56 (281 days) | 2024-04-06 08:24:14 (86 days) |
 Pro Tip: Get Good | 2023-09-22 15:43:15 (282 days) | 2024-04-06 08:24:14 (86 days) |
 rocky | 2023-09-22 10:38:23 (282 days) | 2024-04-06 08:24:14 (86 days) |
 Liilay | 2023-09-20 13:26:20 (284 days) | 2024-04-06 08:24:14 (86 days) |
 Roleste | 2023-09-20 09:14:37 (284 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198051415706 | 2023-09-19 15:31:06 (285 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198188165585 | 2023-09-19 05:03:17 (286 days) | 2024-04-06 08:24:14 (86 days) |
 Crybaby | 2023-08-29 17:10:39 (306 days) | 2024-04-06 08:24:14 (86 days) |
 ⛥ProstiCute Skittles⛥ | 2023-08-05 01:00:53 (331 days) | 2024-04-06 08:24:14 (86 days) |
 Watermelon {JESUS IS LORD} | 2023-07-19 04:04:54 (348 days) | 2024-04-06 08:24:14 (86 days) |
 MegoZero | 2023-07-16 05:13:53 (351 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198034747271 | 2023-07-15 04:00:51 (352 days) | 2024-04-06 08:24:14 (86 days) |
 Swoopling | 2023-07-13 07:58:31 (354 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198243737724 | 2023-07-08 08:13:49 (359 days) | 2024-04-06 08:24:14 (86 days) |
 ElCreator | 2023-07-05 12:05:56 (361 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198047919988 | 2023-07-05 01:36:43 (362 days) | 2024-04-06 08:24:14 (86 days) |
 Bong Water Salesman | 2023-06-14 00:42:21 (383 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199009264665 | 2023-05-27 08:49:06 (401 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199256447307 | 2023-05-25 08:48:51 (403 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199074221480 | 2023-05-24 12:28:44 (403 days) | 2024-04-06 08:24:14 (86 days) |
 Bͥatͣmͫan | 2023-05-24 11:42:20 (403 days) | 2024-04-06 08:24:14 (86 days) |
 A . J . MASTER 🇵🇪 | 2023-05-22 00:00:38 (406 days) | 2024-04-06 08:24:14 (86 days) |
 Xcho | 2023-05-20 13:25:45 (407 days) | 2024-04-06 08:24:14 (86 days) |
 Віс | 2023-05-20 12:14:33 (407 days) | 2024-04-06 08:24:14 (86 days) |
 Taco Bell Cantina Menu | 2023-05-16 20:55:02 (411 days) | 2024-04-06 08:24:14 (86 days) |
 Daddy Kuma | 2023-05-03 09:25:49 (424 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198133820885 | 2023-04-17 16:41:04 (440 days) | 2024-04-06 08:24:14 (86 days) |
 ✪ janny | 2023-03-19 17:17:34 (469 days) | 2024-04-06 08:24:14 (86 days) |
 Rechow[Sourcebans MARK] | 2023-03-13 10:42:18 (475 days) | 2024-04-06 08:24:14 (86 days) |
 Gubgub | 2023-03-13 01:35:54 (476 days) | 2024-04-06 08:24:14 (86 days) |
 Galen Anthony Gibbs | 2023-02-28 21:55:27 (488 days) | 2024-04-06 08:24:14 (86 days) |
 Vendetta | 2023-02-21 15:38:04 (495 days) | 2024-04-06 08:24:14 (86 days) |
 Clavicle | 2023-02-21 15:33:04 (495 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199128977097 | 2023-02-21 15:28:28 (495 days) | 2024-04-06 08:24:14 (86 days) |
 小风车 | 2023-02-18 13:52:59 (498 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198003151799 | 2023-02-06 12:16:47 (510 days) | 2024-04-06 08:24:14 (86 days) |
 Sexy Ace™[Sourcebans MARK] | 2023-02-04 18:01:14 (512 days) | 2024-04-06 08:24:14 (86 days) |
 Crasherman | 2023-02-04 16:47:57 (512 days) | 2024-04-07 09:41:44 (84 days) |
 Ecco | 2023-02-04 14:11:52 (512 days) | N/A |
 Tristan | 2023-02-04 14:11:47 (512 days) | 2024-04-06 08:24:14 (86 days) |
 SCR3AM | 2022-12-25 09:34:05 (553 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198259844939 | 2022-11-09 07:52:45 (600 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198275684529 | 2022-11-06 05:19:48 (603 days) | 2024-04-06 08:24:14 (86 days) |
 MKM2907 | 2022-10-06 10:42:07 (633 days) | 2024-04-06 08:24:14 (86 days) |
 Chuu can't do this | 2022-09-28 10:24:33 (641 days) | 2024-04-06 08:24:14 (86 days) |
 Maki | 2022-09-25 12:12:27 (644 days) | 2024-04-06 08:24:14 (86 days) |
 Сашенька Трубоёб | 2022-06-28 11:11:44 (733 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199025514096 | 2022-06-12 23:20:31 (749 days) | 2024-04-06 08:24:14 (86 days) |
 ღx̸̘͍̙̒̐͑a̴̢̼͔͌͘v | 2022-04-15 10:17:29 (807 days) | 2024-04-06 08:24:14 (86 days) |
 ✪Max | 2022-04-14 02:55:39 (809 days) | 2024-04-06 08:24:14 (86 days) |
 Montana | 2022-04-01 15:37:13 (821 days) | 2024-04-06 08:24:14 (86 days) |
 Princess Peach | 2022-03-21 09:51:19 (832 days) | 2024-04-06 08:24:14 (86 days) |
 P1NHE1RØ | 2022-03-21 01:31:31 (833 days) | 2024-04-06 08:24:14 (86 days) |
 Zammie | 2022-01-04 02:46:53 (909 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199047962330 | 2021-12-04 05:01:54 (940 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198054646706 | 2021-11-25 12:55:22 (948 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198423640200 | 2021-11-20 13:43:22 (953 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198230489564 | 2021-11-20 13:43:22 (953 days) | 2024-04-06 08:24:14 (86 days) |
 ✞ Your Mom Loves Me ✞ | 2021-11-04 02:29:37 (970 days) | 2024-04-06 08:24:14 (86 days) |
 Alflea | 2021-10-21 14:35:13 (983 days) | 2024-04-06 08:24:14 (86 days) |
 mare_gaming94 | 2021-10-05 14:42:43 (999 days) | 2024-04-06 08:24:14 (86 days) |
 SkullFade | 2021-08-26 06:43:41 (1040 days) | 2024-04-06 08:24:14 (86 days) |
 parthl | 2021-08-09 20:42:48 (1056 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198340541995 | 2021-06-24 05:20:05 (1103 days) | 2024-04-06 08:24:14 (86 days) |
 Wafflez | 2021-05-27 04:05:06 (1131 days) | 2024-04-06 08:24:14 (86 days) |
 Anorak | 2021-05-16 13:26:39 (1141 days) | 2024-04-06 08:24:14 (86 days) |
| 76561199041121986 | 2021-04-29 23:59:17 (1158 days) | 2024-04-06 08:24:14 (86 days) |
 Nic | Slash 'N Cast | 2021-04-28 14:40:24 (1159 days) | 2024-04-06 08:24:14 (86 days) |
 ABiZU | 2021-04-27 15:07:33 (1160 days) | 2024-04-06 08:24:14 (86 days) |
 9 3 | 2021-04-26 19:49:54 (1161 days) | 2024-04-06 08:24:14 (86 days) |
 Cyber7148 | 2021-04-26 14:23:38 (1161 days) | 2024-04-06 08:24:14 (86 days) |
 Shangwi | 2021-04-24 07:31:32 (1164 days) | 2024-04-06 08:24:14 (86 days) |
 Gray | 2021-03-16 11:59:00 (1202 days) | 2024-04-06 08:24:14 (86 days) |
 ❤⃝LIMBO | 2021-03-15 22:14:55 (1203 days) | 2024-04-06 08:24:14 (86 days) |
 𝓙𝓐𝓝𝓐𝓡𝓒𝓗𝓨 | 2021-03-15 16:02:36 (1203 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198411348457 | 2021-03-03 12:12:39 (1215 days) | 2024-04-06 08:24:14 (86 days) |
 King | 2021-03-02 14:40:18 (1216 days) | 2024-04-06 08:24:14 (86 days) |
 ⚡VENUM-UFC⚡ | 2021-03-02 03:42:20 (1217 days) | 2024-04-06 08:24:14 (86 days) |
| 76561198236253314 | 2021-01-28 10:23:56 (1249 days) | 2024-04-06 08:24:14 (86 days) |
 Deep Throat David | 2020-11-16 19:04:54 (1322 days) | 2024-04-06 08:24:14 (86 days) |
 Nooblets | 2020-01-03 08:00:31 (1641 days) | 2024-04-06 08:24:14 (86 days) |
 BigCorporation | 2019-07-15 17:41:26 (1812 days) | 2024-04-06 08:24:14 (86 days) |
 Stings | 2018-11-28 14:55:32 (2041 days) | N/A |